KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327918
Entry
4327918           CDS       T01015                                 
Name
(RefSeq) protoporphyrinogen oxidase, chloroplastic
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Module
osa_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4327918
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     4327918
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     4327918
SSDB
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_9 FAD_binding_3
Other DBs
NCBI-GeneID: 4327918
NCBI-ProteinID: XP_015626054
UniProt: Q9AR38
LinkDB
Position
1:10291892..10295473
AA seq 536 aa
MAAAAAAMATATSATAAPPLRIRDAARRTRRRGHVRCAVASGAAEAPAAPGARVSADCVV
VGGGISGLCTAQALATKHGVGDVLVTEARARPGGNITTAERAGEGYLWEEGPNSFQPSDP
VLTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPGDLPFFDLMSIPGKLRAGLGAL
GVRAPPPGREESVEDFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEDT
GGSIIGGTIKTIQERGKNPKPPRDPRLPTPKGQTVASFRKGLTMLPDAITSRLGSKVKLS
WKLTSITKSDNKGYALVYETPEGVVSVQAKTVVMTIPSYVASDILRPLSSDAADALSIFY
YPPVAAVTVSYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRV
LLLNYIGGSTNTGIVSKTESELVEAVDRDLRKMLINPKAVDPLVLGVRVWPQAIPQFLIG
HLDHLEAAKSALGKGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDYLTKYAYK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgcagccatggccaccgccacctccgccacggcagcgccgccgctc
cgcattcgcgacgccgcgaggaggacccgccgacgcggccacgttcgctgcgccgtcgcc
agcggcgcggccgaggcgcccgcggcgcccggggcgcgggtgtcggcggactgcgtcgtg
gtgggcggcggcatcagcgggctctgcaccgcgcaggcgctggccacaaagcacggcgtc
ggcgacgtgctcgtcacggaggcccgcgcccgccccggcggcaacatcaccaccgccgag
cgcgccggcgagggctacctctgggaggaggggcccaacagcttccagccttccgacccc
gtcctcaccatggccgtggacagcgggctcaaggacgatctcgtgttcggggaccccaac
gcgccgcggttcgtgctgtgggaggggaagctaaggccggtgccgtccaagcccggcgac
ctgccgttcttcgacctcatgagcatccccggcaagctcagggccggccttggcgcgctc
ggcgttcgagcgccacctccagggcgtgaggagtcggtggaggacttcgtgcggcgcaac
ctcggcgcggaggtctttgagcgcctcattgagcctttctgctcaggtgtgtatgctggt
gatccttcaaagctcagtatgaaggctgcatttgggaaggtgtggaggctggaggatact
ggaggtagcattattggtggaaccatcaaaacaatccaggagagggggaaaaaccccaaa
ccgccgagggatccccgccttccaacgccaaaggggcagacagttgcatctttcaggaag
ggtctgactatgctcccggatgctattacatctaggttgggtagcaaagtcaaactttca
tggaagttgacaagcattacaaagtcagacaacaaaggatatgcattagtgtatgaaaca
ccagaaggggtggtctcggtgcaagctaaaactgttgtcatgaccatcccatcatatgtt
gctagtgatatcttgcggccactttcaagtgatgcagcagatgctctgtcaatattctat
tatccaccagttgctgctgtaactgtttcatatccaaaagaagcaattagaaaagaatgc
ttaattgacggagagctccagggtttcggccagctgcatccgcgtagtcagggagttgag
actttaggaacaatatatagctcatcactctttccaaatcgtgctccagctggaagggtg
ttacttctgaactacataggaggttctacaaatacagggattgtttccaagactgaaagt
gagctggtagaagcagttgaccgtgacctcaggaagatgctgataaatcctaaagcagtg
gaccctttggtccttggcgtccgggtatggccacaagccataccacagttcctcattggc
catcttgatcatcttgaggctgcaaaatctgccctgggcaaaggtggttatgatggattg
ttcctcggagggaactatgttgcaggagttgccctgggccgatgcgttgaaggtgcatat
gagagtgcctcacaaatatctgactacttgaccaagtacgcctacaagtga

DBGET integrated database retrieval system