KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327929
Entry
4327929           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4327929
   04141 Protein processing in endoplasmic reticulum
    4327929
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4327929
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4327929
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4327929
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 4327929
NCBI-ProteinID: XP_015650877
UniProt: A0A8J8YE10 Q0JLV5
LinkDB
Position
1:21631119..21635478
AA seq 80 aa
MVANGDAPARGSAAAAASLRRRRTTSSGTGGGGASTMLQFYTDEAAGRKMSPNSVLIMSI
GFIAVVALLHVFGKLYRTSA
NT seq 243 nt   +upstreamnt  +downstreamnt
atggtggccaatggagatgccccggctagagggagtgcagcagctgctgcaagcttgcgc
aggcgtagaaccaccagcagtggcactggtggaggcggtgccagcacaatgctccagttc
tacaccgatgaggctgctgggcgcaagatgtccccgaactcagtcctcatcatgagcatt
gggttcattgccgtcgttgctcttctgcatgttttcggcaagctttaccgcacctccgcc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9266625
Entry
9266625           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    9266625
   04141 Protein processing in endoplasmic reticulum
    9266625
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9266625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    9266625
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   9266625
SSDB
Motif
Pfam: Sec61_beta Spore_YtfJ
Other DBs
NCBI-GeneID: 9266625
NCBI-ProteinID: XP_015618728
UniProt: Q2QX17 A0A8J8XGT9
LinkDB
Position
12:3718740..3720335
AA seq 83 aa
MPANGDGPARGSAAAAASLRRRRTTGGAGAGARGGTSTMLQFYTEEAAGCKMSPNAVLIM
SIGFFAVVALLHVFGKLYRTSSN
NT seq 252 nt   +upstreamnt  +downstreamnt
atgccggctaatggcgatggccctgccagagggagcgcagcagctgccgcaagcttgcgc
aggcgcagaaccactggcggtgccggtgccggtgctagaggtggcaccagcacaatgctt
cagttctacactgaagaggctgctgggtgcaagatgtcccccaatgctgttctgatcatg
agcatcgggtttttcgcggtcgttgcccttctccatgttttcggcaagctataccgtacc
tcctccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269540
Entry
9269540           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    9269540
   04141 Protein processing in endoplasmic reticulum
    9269540
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9269540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    9269540
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   9269540
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 9269540
NCBI-ProteinID: XP_015618773
UniProt: Q2QYX6
LinkDB
Position
12:complement(156366..157086)
AA seq 107 aa
MARSSSQSQSSVGAAAGAARPATVGPRGTAAAAAGMRRRRASTAGGSGGFSGGGGSNMLR
FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAASASA
NT seq 324 nt   +upstreamnt  +downstreamnt
atggctcgctcctcctcccagtcccagtcctccgtcggcgccgccgccggggccgcccgc
cctgccaccgttggcccccgcggcacggccgctgcggccgccggcatgcgccgccgccgc
gcctccaccgccggcggctccgggggcttctccggtggcggcgggagcaacatgctgcga
ttctacaccgacgaggcgcccggcctccgcctctcgcccaccatggtgctcgtcatgtcg
ctctgcttcataggcttcgtcactgccctccacgtcttcggcaagctctaccgctcccgc
accgccgcctccgcctccgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271333
Entry
9271333           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    9271333
   04141 Protein processing in endoplasmic reticulum
    9271333
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9271333
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    9271333
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   9271333
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 9271333
NCBI-ProteinID: XP_015615361
UniProt: Q2RBP5 C7J8C7
LinkDB
Position
11:complement(162757..163485)
AA seq 107 aa
MARSSSQSQSSVGASAGAARPATVGPRGTAAAAAGMRRRRASTAGGSGGFSGGGGSNMLR
FYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRSRTAASASA
NT seq 324 nt   +upstreamnt  +downstreamnt
atggctcgctcctcctcccagtcccagtcctccgtcggcgcctccgccggggccgcccgc
ccggccaccgttggcccccgcggcacggccgctgcggccgccggcatgcgccgccgccgc
gcctccaccgccggcggctccgggggcttctccggtggcggcgggagcaacatgctgcga
ttctacaccgacgaggcgcccggcctccgcctctcgcccaccatggtgctcgtcatgtcc
ctctgcttcataggcttcgtcaccgccctccacgtcttcggcaagctctaccgctcccgc
accgccgcctccgcctccgcctga

DBGET integrated database retrieval system