KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327931
Entry
4327931           CDS       T01015                                 
Name
(RefSeq) protein EARLY FLOWERING 3
  KO
K12125  protein EARLY FLOWERING 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4327931
SSDB
Other DBs
NCBI-GeneID: 4327931
NCBI-ProteinID: XP_015650888
UniProt: Q657D6
LinkDB
Position
1:complement(21637036..21643133)
AA seq 742 aa
MRGGGGGGKEVEERGKVMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFSGG
GGALASARGSLARSTSAASQSQVYGCDMPLFEPFNVPSNGPGQSVEKMNSNSVNRQINGS
RKDSGMLSTQPKGIDKYGSGSRAECAPQQRVEKGIKSSSGRKLADDDEFIVPSVFSARFP
QYSTKERAGVQEESTPLVALSPHKSPPAVSKSPTKCYNTVSKNLERINVSDVKSRGSQKD
KETGPAQTLKNVEVEHFSSFEASKDMFGSKHAKVCPKTGTINDLDEPHLENSEHQATSRN
GSSVKFQNPPVRRNTISAKPSPGIENTNGHCNLPQGGLKEAGTKRKRLEAQDNAEKIDDL
SDSSVECITAWEISPDEIVGAIGAKHFWKARRAIINQQRVFAAQVFELHKLVKVQKLIAA
SPHVLIEGDPCLGNALLASKKKMAEENLKAQPVLVATNDDVQPSLQEPELSKENSEENPP
SPRDTAPVSGHHDQTAKIGASKSNLRATPVASDNRQNNCGVQLQPPQNQWLIPVMSPSEG
LVYKPYSGPCPPAGSILAPFYANCTPLRLPSTTGDFMNSAYGVPIPHQPQHMGAPGTPTM
PMNYFPPFSVPVMNPVALASAVEQGRHPSMPQPYGNLEQHSRMSCNMSHPSGIWRFHASR
DSEAQASSASSPFDRLQCGGSGPVSAFPTASAQNTQPQPSSGSRDNQTNVIRVIPHNNSQ
TASESAARIFRSIQMERQQDDS
NT seq 2229 nt   +upstreamnt  +downstreamnt
atgaggggaggaggaggaggagggaaggaggtggaggagagggggaaggtgatgggcccg
ctgttcccgcggctccacgtcaacgacgccgccaagggcggcggcccgcgggcgccgccc
aggaacaagatggcgctctacgagcagttcaccgtgccgtcccaccgcttcagcggcgga
ggcggcgcgctcgcctcggctcggggcagcctggcgcgctcgacgtcggcggcgagccag
agccaggtatatggatgtgacatgcctctttttgagccgttcaatgtgccttccaatgga
cctggccagtctgttgaaaagatgaattcaaattctgtcaacagacagattaatggttca
agaaaagattcggggatgttatccactcagcctaagggcattgataaatatggttcagga
tcaagggctgagtgtgccccacagcaaagggtggaaaagggcataaagagttcttcggga
aggaaattggctgatgatgatgaattcattgtaccttctgttttcagtgccagatttcct
caatattctactaaagagcgtgcgggggttcaagaggaatcaacaccccttgttgctctc
agtccgcacaaaagccctccagcagtgtccaaatcaccgacaaagtgttataacactgtt
agtaagaacttggagagaatcaatgtttctgatgtgaaatcaaggggttctcagaaagac
aaggagacaggaccagcacaaacattgaaaaatgtggaagttgaacatttttcatcattt
gaggcatccaaagatatgtttggaagcaaacatgctaaagtatgtcctaagacaggcact
ataaatgatttggatgagccacatttggaaaacagcgagcatcaagcgacaagtagaaac
gggagttccgtgaaatttcagaaccctccagtgagaagaaatacaatatccgctaaacca
tctcctggtattgaaaataccaatgggcattgtaatttacctcaaggaggcttaaaggaa
gctggtacaaagagaaaaaggttggaagcacaggataatgcagagaaaattgatgatttg
tctgattcctcagtggagtgtataactgcttgggagatttctccagatgaaattgttggt
gccattggtgcaaagcatttttggaaagcaaggcgggctatcataaatcaacagagggtt
tttgctgcccaagtttttgagctgcataagttggtaaaagtgcagaagttgattgcagca
tcgccacatgtacttattgaaggtgatccttgccttggcaatgccttgttagctagcaag
aaaaaaatggcggaagagaacttgaaagctcagcctgtgttagttgcaaccaatgatgat
gtgcagccaagtctacaggaaccagaattatcgaaagaaaattctgaagagaacccaccc
tctcctcgtgatactgcacctgtcagtggtcatcatgatcaaactgcaaaaatcggtgca
tcaaaaagcaatcttcgagctacgcccgttgcttctgataacagacagaataactgtggg
gttcaactacaaccaccgcagaatcagtggcttatccctgtcatgtctccttcagaaggg
cttgtctataagccttattctggcccatgtcctccagccggaagcatattggccccattt
tatgccaattgtactcccctgaggctcccatcgacaactggagatttcatgaattcagca
tatggtgttcctatacctcatcaaccacaacatatgggtgctcctggcactcctaccatg
cctatgaactacttcccgcctttcagtgtaccagtgatgaacccagttgcactagcatct
gcagtagaacaaggcaggcatccttctatgccacagccttatgggaacttggagcaacac
tctcggatgtcatgcaacatgtcacatccaagtggcatttggagatttcatgcctcaaga
gatagtgaggcgcaagccagcagcgctagcagtccttttgacaggctccaatgcggtgga
agtggtcctgtgtccgccttccctacagcatcagctcagaacacacagcctcagccctca
tctggcagccgggacaaccagaccaatgttattagggtcattccgcataataattcacaa
acagcttcagagtcagcagcacggattttccggtcaatacagatggaaaggcaacaagat
gactcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340087
Entry
4340087           CDS       T01015                                 
Name
(RefSeq) protein EARLY FLOWERING 3
  KO
K12125  protein EARLY FLOWERING 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4340087
SSDB
Other DBs
NCBI-GeneID: 4340087
NCBI-ProteinID: XP_015642489
UniProt: Q9SNQ6
LinkDB
Position
6:complement(2234155..2239184)
AA seq 760 aa
MATRGGGGGGGGKEAKGKVMGPLFPRLHVNDAAKGGGPRAPPRNKMALYEQFTVPSHRFS
GGGGGGGVGGSPAHSTSAASQSQSQSQVYGRDSSLFQPFNVPSNRPGHSTEKINSDKINK
KISGSRKELGMLSSQTKGMDIYASRSTAEAPQRRAENTIKSSSGKRLADDDEFMVPSVFN
SRFPQYSTQENAGVQDQSTPLVAANPHKSPSTVSKSSTKCYNTVSKKLERIHVSDVKSRT
PLKDKEMEAAQTSKNVEVEKSSSFHASKDMFESRHAKVYPKMDKTGIINDSDEPHGGNSG
HQATSRNGGSMKFQNPPMRRNEISSNPSSENTDRHYNLPQGGIEETGTKRKRLLEQHDAE
KSDDVSRLLEQHDAENIDDVSDSSVECITGWEISPDKIVGAIGTKHFWKARRAIMNQQRV
FAVQVFELHKLVKVQKLIAASPHVLIESDPCLGNALLGSKNKLVEENLKAQPLLVATIDD
VEPSLQQPEVSKENTEDSPPSPHDTGLGSGQRDQAATNGVSKSNRRATPVASDNKQNNWG
VQLQPPQNQWLVPVMSPLEGLVYKPYSGPCPPAGSILAPFYANCTPLSLPSTAGDFMNSA
YGVPMPHQPQHMGAPGPPSMPMNYFPPFSIPVMNPTAPAPVVEQGRHPSMPQPYGNFEQQ
SWISCNMSHPSGIWRFHASRDSEAQASSASSPFDRFQCSGSGPVSAFPTVSAQNNQPQPS
YSSRDNQTNVIKVVPHNSRTASESAARIFRSIQMERQRDD
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcgacgaggggaggaggcggaggaggaggagggaaggaggcgaaggggaaggtgatg
ggcccgctgttcccgcggctccacgtcaacgacgcggccaagggcggaggcccgcgggcg
ccgccccggaacaagatggcgctctacgagcagttcaccgtgccctcgcatcgcttcagc
ggcggaggaggcggcggcggagtaggaggcagccccgcgcactcgacgtcggcggcgagc
cagagccagagccagagccaggtttatggacgtgacagttctctgttccagccgttcaat
gtgccttccaatcgacctggccattctactgaaaagatcaattcagataagatcaacaag
aagattagtggttcaagaaaagaactggggatgttatcctctcagactaagggcatggat
atttatgcttcaagatcaactgctgaggcaccacaaagaagagcagaaaatacaataaag
agttcttcgggaaagagattggccgatgatgatgaatttatggttccttctgtcttcaat
tccagatttcctcaatatagtactcaagagaatgcaggggttcaagaccaatcaacaccc
cttgttgctgcaaatccacacaaaagcccttcaacagtgtccaaatcatccacaaagtgt
tataacactgttagcaagaaattggagagaatccatgtttctgatgtgaaatcaaggacc
cctttgaaagacaaggagatggaagcagcacagacatccaaaaacgtggaagttgaaaaa
agttcatcctttcatgcttccaaagatatgtttgaaagcaggcatgctaaagtatatcct
aagatggataagacgggcattataaatgattctgatgagccacatggtggaaatagtggg
catcaagcgacaagcagaaatggaggttccatgaaatttcagaaccctccaatgagaaga
aatgaaatttcctctaatccatcttctgaaaatactgataggcattataatttaccgcaa
ggaggcatagaggaaacaggtacaaagagaaaaaggttgctagaacaacacgatgcagag
aaaagtgatgatgtgtcaaggttgctagaacaacacgatgcagagaacattgatgatgtg
tctgattcctcggtggagtgtataactggttgggagatttctccagataaaattgttgga
gccattggtacaaagcatttctggaaagcaagacgtgctattatgaatcaacagagggtg
tttgctgtccaggtttttgagctgcataagttggtaaaagtgcagaagttgattgcagca
tcgccacatgtacttattgaaagtgatccttgccttggcaatgccttgttgggtagcaag
aacaagctggtggaagaaaacctgaaagcacaacctcttttagtcgcaaccatcgatgac
gtggagccaagtctacagcaaccggaggtatcaaaagaaaacactgaagacagcccaccc
tcccctcatgatactgggcttggcagtggtcaacgtgatcaagctgcaacaaatggcgtc
tctaaaagcaatcgtcgagctacacctgttgcttctgataacaaacaaaataactggggc
gttcaacttcaaccacctcaaaatcaatggcttgtccctgtcatgtctcctttggaaggc
cttgtctataagccttattctggtccgtgccctccagctggtagcatattggccccgttt
tatgccaactgtactcctttgagtcttccatcaacagctggagatttcatgaactcggca
tacggtgttcctatgcctcatcagccacaacatatgggtgctcctggccctccttccatg
cctatgaactacttcccgcctttcagcataccagtgatgaacccaactgcaccggcacct
gtagtcgaacaagggagacatccttcgatgccacagccttatgggaactttgagcagcag
tcgtggatctcatgtaacatgtcacatccaagtggcatttggagatttcatgcctcaaga
gatagcgaggcacaggccagcagcgctagcagtccttttgacaggttccaatgcagtgga
agtggtcctgtatccgccttccccacagtatcagctcagaacaaccagcctcagccctca
tatagcagccgggacaaccagaccaatgttatcaaggttgttccacataattcacgaact
gcttcagagtcagcagcacggattttccggtcaatacaaatggaacggcaacgagatgat
tga

DBGET integrated database retrieval system