KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327936
Entry
4327936           CDS       T01015                                 
Name
(RefSeq) L-gulonolactone oxidase 3
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4327936
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4327936
SSDB
Motif
Pfam: ALO FAD_binding_4
Other DBs
NCBI-GeneID: 4327936
NCBI-ProteinID: XP_015621824
UniProt: A0A0N7KDJ2 Q8S9W7
LinkDB
Position
1:complement(28376377..28381070)
AA seq 592 aa
MVATFLLPLLLSTLLPAAVPLPPRPPVRCGGSGGAGGDGAGCVLSNAYGAWSSDRADCPV
SAVAYPASEADVVAVVADASAKNMPVKVVSGFAHTIPKLACPGNGSSGAASSLLISTARY
DGVAVDAAARTVTADAGAPLRAVIDAAEASGLSLTAAPYWEGVSVGGLVSTGSHGSSWWG
RGGAVHDHVVALRLVVPAGAADGWAKVVALRRGDALFNAALVSLGLLGVISKVTLALEPR
FKRSISYEYRDDSTFQDDFARHAANHEFADITWYPSQHKAVYRIDDRMPLNATGDGVNDF
IGFQSTLIAVSSGIRALETALEASRNVKGKCKMAAAEIAAKRLVGNGLRGAGGRLFTGYP
VVGFQGRMQTSGSCARSPPTDTLSACPWDPRYKGLFFYESTAMFSPAARFRDFVLDVKRL
RDVDPDSMCGVDAYNGLLVRFVKASEAYLGQPEDTVVVDFNYYRASDGSSPRLSQDVWEE
VEQLAFVKHGARPHWAKNRLAAFRGVRGKYPSWDKFGAAKRQLDPRGLFDSRWSDEVVGG
EEQLPKADGCALEGRCVCSEDRHCSPSKGYYCRPGLVYSEARVCRYSVSQLV
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggtcgccacctttctcctccccctcctactctccaccctgctgcccgccgccgtcccg
ctgccgccgcgcccgcctgtgcggtgtggcggtagcggcggcgccggcggcgatggggca
ggctgcgtgctctccaacgcctacggcgcgtggtcgagtgaccgcgccgactgccccgtc
tcggccgtcgcgtacccggcgtccgaggctgacgtggtcgcggtcgtcgccgacgccagc
gccaagaacatgcccgtcaaggtcgtcagcggcttcgcgcacaccatcccgaaactggcg
tgccccgggaacggcagcagcggcgcggcctcctccttgctcatcagcacggcgaggtac
gacggcgtggcggtcgacgccgccgcgcggacggtgaccgcggacgccggcgcgccgctg
cgggccgtgatcgacgcggcggaggcgagcgggctgagcctgacggcggcgccgtactgg
gaaggggtgagcgtcggggggctcgtcagcacgggctcccacgggagctcctggtggggc
cgcggcggcgccgtgcacgaccacgtggtggcgctcaggctcgtcgtgcccgccggcgcg
gcggacgggtgggccaaggtggtggcgctccggagaggcgacgcgctcttcaacgccgct
ctcgtctccctcggcttgctaggggttatctcaaaggtgactctggctctggagccaagg
ttcaagagaagcataagctacgagtacagggacgactccaccttccaggacgacttcgca
cgccacgccgcgaaccacgagttcgccgacatcacctggtacccgtcgcagcacaaggcg
gtatacaggatcgacgaccgcatgccgctcaacgccacgggcgacggcgtcaacgacttc
atcggcttccagtccacgctcatcgccgtctcctccggcatcagggccctcgagaccgcg
ctggaggcgtccaggaacgtgaagggcaagtgcaagatggcggcggcggagatcgcggcg
aagaggctcgtcggcaacgggctgcgcggcgccggcgggcggctgttcacgggctacccc
gtggtggggttccaggggaggatgcagacgtcgggctcctgcgcgcgctcgccgcccacc
gacacgctcagcgcgtgcccctgggaccccaggtacaagggcctcttcttctacgagagc
acggcgatgttctcgcctgcggcgaggttccgcgacttcgtcctcgacgtcaagcggctg
cgcgacgtcgacccggacagcatgtgcggcgtcgacgcgtacaacggcctcctcgtcaga
ttcgtgaaggcgtcggaggcatacctgggccagccggaggacaccgtggtggtggacttc
aactactaccgcgcgtcggacgggtcgtcgccgcggctgagccaggacgtgtgggaggag
gtggagcagctggcgttcgtcaagcacggggcgcgcccgcactgggccaagaacaggctg
gcggcgttccggggcgtgcggggcaagtacccgagctgggacaagttcggcgcggcgaag
cggcagctcgacccgcgggggctgttcgacagccggtggtccgacgaggtcgtcggcggg
gaggagcagctgcccaaggccgacggctgcgcgctggagggccgctgcgtctgctccgag
gacaggcactgcagcccgagcaaggggtactactgcagaccggggctcgtttattcagag
gccagggtctgcaggtactccgtttcgcaactagtctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328142
Entry
4328142           CDS       T01015                                 
Name
(RefSeq) L-gulonolactone oxidase 2
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4328142
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4328142
SSDB
Motif
Pfam: FAD_binding_4 ALO
Other DBs
NCBI-GeneID: 4328142
NCBI-ProteinID: XP_015624969
LinkDB
Position
2:complement(1263502..1266098)
AA seq 611 aa
MQQLQARRRRGAPGGRRRITHGAPLLAAVAVLLCASVRFAGASPPPGPVRCASGTANCTV
TNAYGAFPDRSTCRAAAAAYPASERELLRVVAGAAASRTKMKVATRYGHSVPKLACPGDG
GGGGGGLVISTDALNRVVAVDAGRMEITVESGVTLAELIDAAAGGGLALPHSPYWLGLTV
GGLLSTGAHGSSVWGKGGAVHEYVVGMRIVTPAPASEGHAKVRVLAAGDPELDAAKVSLG
VLGVISQVTLKLQPMFKRSVAFRRRDDDDLAERVAAFAGEHEFADILWLPSQGKAVYRID
DRVPNTTSGDGAVYDLVVFQSSPTVAIQANRIGEDALEATANSAGKCLAGSATIARLAAG
NYGVTRRGVLPPPPGAAVVGYQNRIQSSGSCLSGADDGLLTACTWDPRVRHNSFFFQSGI
SVPLSGAAAFIRDVQRLRDLNPDALCGLEVYYGVLLRYVRASTAHLGKPEDSVELDLTYY
RSRDPAAPRLHEDAVEEIEQMALRKYGGVPHWGKNRNAAFDGAIAKYPKSGEFLKVKGSY
DPEGLFSSEWSDKVLGVAGAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLCRPGRVYKE
ARVCRRVAGDH
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcagcagctgcaagctcgccgccggcgaggtgcaccgggtggtcgccggcgcatcacc
catggcgctccactcctcgccgccgtggccgtgcttctctgcgcaagtgttcgcttcgcc
ggcgccagcccgccgccggggccggtcaggtgcgcgtcgggcacggccaactgcaccgtg
accaacgcgtacggcgcgttcccggaccgctccacgtgccgcgccgccgccgcggcgtac
ccggcgtccgagcgggagctcctccgcgtcgtcgccggcgccgcggcgtccaggaccaag
atgaaggtggcgacgcggtacggccacagcgtgcccaagctggcctgccccggcgacggc
ggcggcggcggcggcggcctcgtcatcagcaccgacgcgctgaaccgcgtggtcgccgtg
gacgccggaaggatggagatcacggtggagagcggcgtgacgctggcggagctgatcgac
gccgcggcgggcggcggcctcgcgctgccgcactcgccgtactggctggggctcaccgtc
ggcgggctgctgtcgacgggcgcgcacgggagctcggtgtgggggaagggcggcgccgtg
cacgagtacgtcgtcggcatgaggatcgtcacgccggcgccggcgagcgaggggcacgcc
aaggtccgcgtgctcgccgccggcgacccggagctggacgccgccaaggtgtcgctcggc
gtgctcggggtcatttctcaggtaactctaaagctgcaaccaatgttcaagcgctcggtg
gcgttccggcggcgcgacgacgacgacctggcggaacgagtcgccgccttcgccggcgag
cacgagttcgccgacatcctctggcttcccagccaaggcaaggccgtgtaccggatcgac
gaccgcgtgcccaacaccacctccggcgatggcgccgtctacgatctcgtcgtcttccag
tcgagccccacggtcgccatccaggccaataggattggcgaggacgccctcgaagcgacg
gcgaactccgccggcaagtgcctcgccgggtcggcgacgatagcccgcctcgccgccggc
aactacggcgtcacgaggcgcggcgtgctcccgccgccgcccggcgcggcggtggtcggc
taccagaaccgcatccagtcgtcggggtcctgcctctccggcgccgacgacggcctcctc
accgcctgcacgtgggacccacgcgtcaggcacaactccttcttcttccagtccggcatc
agcgtgccgctctccggcgcggcggcgttcatccgcgacgtgcagcggctgcgcgacctc
aacccggacgcgctctgcggcctcgaggtgtactacggcgtcctcctccgctacgtcagg
gcgtcgacggcgcacctcggcaagcctgaggacagcgtcgagctcgacctcacctactac
cggagccgcgacccggcggcgccgcggctgcacgaggacgcggtggaggagatcgagcag
atggcgctgcgcaagtacggcggcgtcccgcactggggcaagaaccggaacgccgccttc
gacggcgccatcgccaagtacccgaagtccggcgagttcctcaaggtgaagggcagctac
gaccccgaggggctcttctccagcgagtggagcgacaaggtgctcggcgtcgccggcgcc
ggcggcgtgagcgtggtgagggacgggtgcgcgctggaggggctgtgcgtgtgctcggag
gacgcgcactgctcgccggagaagggctacctctgccggccgggaagggtgtacaaggag
gccagggtgtgccggcgtgtcgccggcgatcactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328143
Entry
4328143           CDS       T01015                                 
Name
(RefSeq) probable L-gulonolactone oxidase 6
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4328143
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4328143
SSDB
Motif
Pfam: FAD_binding_4 ALO FAD-oxidase_C
Other DBs
NCBI-GeneID: 4328143
NCBI-ProteinID: XP_015624834
UniProt: Q0E4D5
LinkDB
Position
2:complement(1273223..1275596)
AA seq 599 aa
MQGSVVTARRAVHGILVAVVVVQRLLAAGASPPADPVHCASGTARCTVTNAYAAFPDRST
CRAAAAAYPASEEELLRVVAAAAASGTKMKAATRYGHSVPKLSCPGAGDGRGLAISTSAL
NRVVAVDAAGMAITVESGVTLAELIDAAAGAGLALPHSPYWLGVTVGGLLSTGAHGSSVW
GNGSAVHEYVNGMRIVTPAPAREGYAKVRVLAAGDPELDAAKVSLGVLGVISQVTLKLQP
MFKRSVAFQHCGDGDLAERVVAFAGEHEFADILWYPGHGKAVYRIDDRVPSNTPGDGVYD
FVGFRATPTLAIQAKRLVEDGLEATGNAAGKCLAASTTNSILAARNYGLTRNGQLLGAFP
GTAVVGYQNRIQSSGSCLAGADDGLLTACPWDPRVEHGTFFFQSGISVPLSRAAAFIRDV
QRLRDLNPDALCGVELYDGVLMRYVRASAAHLGKPEDSVDFDLTYYRSRDPATPLLHEDV
VEEVEQMALRKYGGVPHWGKNQNAAFEGAAAKYGGARAAAFMRVKRAYDPEGLFSSEWSD
KVLGVAGAGGVSVVRDGCALEGLCVCSEDAHCSPEKGYLCRPGRVYKEARVCRRVADDL
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgcaaggttcagtagtgacagcaaggcgcgctgtccatggcatcctcgtcgccgtcgtg
gtggtgcagcgcctcctcgccgccggcgccagtccgccggcggatcccgtccattgcgcg
tcggggacggcgcgctgcaccgtgaccaacgcgtacgccgcgttcccggaccggtccacg
tgccgggcggccgccgcggcgtacccggcgtcggaggaggagctcctccgcgtggtggcc
gcggcggcggcgtccgggaccaagatgaaggcggcgacgcggtacgggcacagcgtgccg
aagctgtcctgccccggcgccggcgacggccgcggcctcgccatcagcaccagcgcgctg
aaccgcgtcgtcgccgtggacgccgcggggatggcgatcacggtggagagcggcgtgacg
ctggcggagctgatcgacgccgcggcgggcgccggcctcgcgctgccgcactcgccgtac
tggctgggcgtcaccgtcggcggcctcctctccaccggcgcgcacgggagctcggtgtgg
gggaatggctccgccgtgcacgagtacgtgaacggcatgaggatcgtcacgccggcgccg
gcgagagaggggtacgcgaaggtccgcgtgctcgccgccggcgacccggagctggacgcc
gccaaggtgtcgctcggggtgctcggggtcatttcccaggttactctaaaactgcagccg
atgttcaagaggtcggtggcgttccagcactgcggcgacggcgacctggcggaacgagtc
gtcgccttcgccggcgagcacgagttcgccgacatcctctggtaccccggccatggcaag
gccgtgtaccggatcgacgaccgcgttcccagcaacacgccgggcgatggcgtctacgat
ttcgtcggcttccgggccaccccaacgctcgccatccaggccaaaaggctcgtcgaggac
ggcctggaagcgaccgggaatgccgccggcaagtgcctcgcggcgtcgacgacgaactcc
atcctcgcagcccgcaactacggcctgacgaggaacggccagctgctcggcgcgttcccc
ggcacggcggtggtcggctaccagaaccgcatccagtcgtcgggatcctgcctcgccggc
gccgacgacggcctcctcaccgcctgcccgtgggatccccgcgtcgagcacggcacgttc
ttcttccagtccggcatcagcgtgccgctgtccagggcggcggccttcatccgcgacgtg
cagcggctgcgcgacctcaacccggacgcgctctgcggcgtggagctctacgacggcgtc
ctcatgcgctacgtcagggcgtcggcggcgcacctcggcaagccggaggacagcgtcgac
ttcgacctcacctactaccggagccgcgacccggcgacgccgcttctgcacgaggacgtg
gtggaggaggtcgagcagatggcgctgcgcaagtacggcggcgtcccgcactggggcaag
aaccagaacgcggcgttcgagggcgccgccgccaagtacggcggcgcgcgcgccgcggcg
ttcatgagggtgaagcgggcgtacgaccccgaggggctcttctccagcgagtggagcgac
aaggtgctcggcgtcgccggcgccggcggcgtgagcgtggtgagggacgggtgcgcgctg
gaggggctgtgcgtgtgctcggaggacgcgcactgctcgccggagaagggatacctctgc
cggccgggaagggtgtacaaggaggccagggtgtgccggcgtgtcgccgacgatctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333257
Entry
4333257           CDS       T01015                                 
Name
(RefSeq) L-gulonolactone oxidase 2
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4333257
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4333257
SSDB
Motif
Pfam: FAD_binding_4 ALO
Other DBs
NCBI-GeneID: 4333257
NCBI-ProteinID: XP_015629041
UniProt: Q10I64 Q0DQT2
LinkDB
Position
3:20240328..20245182
AA seq 604 aa
MSLEHNKMMITLVRLLPLVLVVALAWPAAEAPAAASPPPDPVQCSSGSGTADCTVSSAYG
VFPDRSTCRAAAAVYPSTEEELVRAVANATASGTKMKVATRYSHSIPQLACPGDGDGEGL
VISTRRLNRVVAVDAGRMEVTVESGISLRELIAEAGKAGMALPYAPYWWGLTVGGMLGTG
AHGSSLWGKGSAVHEYVVGMRIVTPAPAADGYAKVRVLTAADPELDAAKVSLGVLGVISQ
VTLALQPLFKRSVTFMERDDDDLADQVTKFGYQHEFADIAWYPGIGRAVYRVDDRLPMNA
SGEGVLDFIGFRATPRLLIRTNRLAEELFERAGNGNGKCVTSRVTHAALSSAGYGLMRRS
GGLFTGYPVVGPQHLMQASGGCITGPEDALLTACPWDPRVRGSSFFHQTTFSLPVSRAGA
FVEEVRRLRDMNPKALCGVELYDGILIRYVKASTAHLGKPAAGGGQSDDMVDFDMTYYRS
RDPNRARLFEDVLEEIEQMGVFKYGGLPHWGKNRNLAFVGAARKYPRIGEFLRIKDAYDP
DGLFSSDWSDMMLGIGGRAPTRDAPGCALEGMCVCSQDAHCAPEQGYVCRPGKVYKDARV
CTKV
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgagcctcgagcacaacaagatgatgatcactctcgtgcggttgctgccgctcgtcctc
gtcgtggcattggcgtggcctgcggctgaggcgccggccgccgcgagccccccaccggac
ccggtgcagtgctcgtccggcagcggcacggccgactgcaccgtgtcgagcgcgtacggc
gtcttcccggaccggtcgacgtgccgcgcggccgccgccgtgtatccttctacggaggag
gagctggtccgggccgtggccaacgcgacagcgtccgggaccaagatgaaggtggccacc
aggtactcccacagcatcccgcagctggcctgccccggcgacggcgacggcgagggcctc
gtcatcagcactaggcggctcaaccgcgtggtggccgtcgacgccggcaggatggaggtg
acggtggagagcggcatatcgctgcgggagctcatcgccgaggcgggcaaggccgggatg
gcgctgccgtacgcgccctactggtgggggctcaccgtgggcggcatgctcggcacgggc
gcgcacggcagctcgctgtgggggaaaggcagcgccgtgcacgagtacgtggtcgggatg
cgcatcgtcacgccggcgcccgccgccgacgggtacgccaaggtgcgggtgctcaccgcg
gccgacccggagcttgacgccgccaaggtctccctaggcgtcctaggagtcatttctcag
gtgactctggcgctgcaacctctgttcaagcgttctgtgacgttcatggagcgcgacgac
gacgacctggcggaccaggtgaccaagttcggctaccagcacgagttcgccgacatcgcc
tggtacccgggcatcgggcgagcggtgtaccgcgtggacgaccggctgccgatgaacgcc
tccggcgagggcgtcctcgacttcatcggcttccgtgccacgccgagacttctgatccgt
actaaccgcctcgcggaggagctgttcgagcgcgcgggcaacggcaacggcaagtgcgtg
acgtcaagggtcacccacgcggcgctctcgtcggccgggtacgggctgatgcggcggagc
ggcgggctgttcaccgggtacccggtggtgggcccgcagcacctgatgcaggcgtccggc
ggctgcatcaccgggccggaggacgcgctcctgacggcgtgcccgtgggacccccgggtg
aggggctccagcttcttccaccagaccaccttcagcctgccggtgagccgtgccggggcg
ttcgtcgaggaggtccggcggctccgtgacatgaaccccaaagcgctctgcggtgtggag
ctctacgacggaatcctgatccgctacgtcaaggcgtcgaccgcgcacctcgggaaaccg
gcggcaggaggcggccagtcggacgacatggtggacttcgacatgacgtactaccgcagc
cgcgaccccaacagggcgcggctgttcgaggatgtcctggaggagatcgagcagatgggg
gtgttcaagtacggcggcctgccgcactggggcaagaaccgcaacctcgccttcgtcggc
gccgcccgtaagtacccgcgcatcggcgagttcctccgcatcaaggacgcctatgacccc
gacggcctcttctccagcgactggagcgacatgatgcttggcattggcggccgtgcgccg
accagggacgcgccgggttgcgcgctggaggggatgtgtgtgtgctcgcaggacgcgcac
tgcgcgccggagcaaggttatgtgtgtcgccccggcaaggtgtacaaggatgccagggtc
tgcaccaaggtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344509
Entry
4344509           CDS       T01015                                 
Name
(RefSeq) probable L-gulonolactone oxidase 4
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4344509
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4344509
SSDB
Motif
Pfam: FAD_binding_4 ALO pYEATS
Other DBs
NCBI-GeneID: 4344509
NCBI-ProteinID: XP_015650881
UniProt: Q6YXT5 A0A0P0XB74
LinkDB
Position
8:complement(768339..770913)
AA seq 589 aa
MRTMLPLLVILVVGLRLAGASPPPQPVACTKGTTDCTVTNVYGSFPDRTICRAADASFPR
TEAELVAAVAAAAAAGRKAKAATRHSHSFPKLACPGGRDGTIISTRFLNRTVAVDAAARR
ITVESGVVLRDLIRAAAAAGLALPHSPYWYGLTVGGLLATGAHGSSLWGKGSAVHEYVVG
LRIVTPAPASQGFAVVRELVAGDPDLDAAKVSLGVLGVISQVTFELQPQFKRSVRFVTRD
DSDFAEKVAVWGGAHEFGDMAWLPRQGKVIYREDDRVDVATPGNGLNDYLGFRAQPTLGL
ITARAAEERLERNGTDIARCLAARLPPSLFELQAYGFTNDGVFFTGWPVVGFQHRIQASG
TCISSPEDGLLSSCTWDPRIRGPFLYNSGFSIALPRAAAFVADMMRLRDLNPRAFCDIDA
KLGILMRYVKASSAYLGKPEDCVDFDVTYYRSYDDGEPRPHSDVFDELEQMALRKYGAVP
HWGKNRNFAFDGAAAKYPNSGEFIKVKERYDPDGIFSSEWSDQVLGISGSPNIVDKRCAI
EGLCVCSDDSHCAPELGYFCRPGKLFKEARVCSKDKSAAAGDDDLLDEL
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgaggacgatgcttcctctcctcgttatcctcgtcgtcgggctccggctcgccggcgcg
agccctccgccgcagccggtggcctgcaccaagggcaccaccgactgcacggtgaccaac
gtgtacggctccttccccgaccgcaccatctgccgcgccgccgacgcgtcgttcccgcgc
acggaggcggagctcgtggcggccgtggcggcggcggcggcggcggggcggaaggcgaag
gcggcgacgaggcactcccacagcttccccaagctggcgtgccccggcggccgcgacggc
accatcatcagcacccggttcctcaaccgcacggtggccgtcgacgcggcggcgcggcgg
atcaccgtcgagagcggcgtcgtgctgcgggacctcatcagggccgccgccgccgccggc
ctcgcgctgccgcactcgccctactggtacggcctcaccgtcggcggcctcctcgccacc
ggcgcccatggcagctcgctctggggcaagggtagcgccgtgcacgagtacgtcgtcggg
ctacgcatcgtcaccccggccccggcgagccaggggttcgccgtcgtcagggagctcgtc
gccggcgaccccgacctcgacgccgccaaggtctccctcggcgtcctcggcgtcatctct
caggtgacattcgagttgcagccgcagttcaagaggtcggtgaggttcgtgacgcgggac
gactcggacttcgcggagaaggtggcggtgtggggcggcgcgcacgagttcggcgacatg
gcgtggctgccgcggcaggggaaggtgatctaccgggaggacgaccgcgtcgacgtggcc
acgccggggaacggcctcaacgactacctcggcttccgcgcgcagccgacgctgggcctc
atcaccgccagggccgccgaggagcggctggagaggaacggcaccgacatcgcccgctgc
ctcgcggcgcggctgccgccgtcgctgttcgagctccaggcctacggcttcaccaacgac
ggcgtcttcttcaccggctggccggtggtcgggttccagcaccggatccaggcgtcgggg
acgtgcatcagctcgccggaggacggcctcctctcctcctgcacctgggacccacggatc
cgggggcccttcttgtacaactccggcttcagcatcgcgctgcccagggcggcggcgttc
gtcgccgacatgatgcggctgcgcgacctcaacccgcgggccttctgcgacatcgacgcc
aagctcggcatcctcatgcgctacgtcaaggcgagctccgcctacctcggcaagccggag
gactgcgtcgacttcgacgtcacctactaccggagctacgacgacggcgagccgcgcccg
cactccgacgtgttcgacgagctggagcagatggcgctgcgcaagtacggcgccgtcccg
cactgggggaagaaccgtaacttcgccttcgacggcgccgccgccaagtaccccaactcc
ggcgagttcatcaaggtgaaggagagatacgaccccgacggcatcttctccagcgagtgg
agcgaccaggtgctgggcatcagcgggagccccaacatcgtcgacaagcgctgcgccatt
gaaggcctctgcgtctgctccgacgactcccactgcgcgccggagctcggctacttctgc
cgcccggggaagcttttcaaggaggccagggtctgctccaaagacaaatccgccgccgcc
ggtgatgatgatctcctcgatgaattgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346054
Entry
4346054           CDS       T01015                                 
Name
(RefSeq) L-gulonolactone oxidase 5
  KO
K00103  L-gulonolactone oxidase [EC:1.1.3.8]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00053  Ascorbate and aldarate metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    4346054
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     4346054
SSDB
Motif
Pfam: FAD_binding_4 ALO
Other DBs
NCBI-GeneID: 4346054
NCBI-ProteinID: XP_015648592
UniProt: Q7EZA7 Q6ZBK9
LinkDB
Position
8:complement(25769814..25771543)
AA seq 508 aa
MQGSVGVHGILLLAAAAVLTQCLLAAAVNTPVVQCASGTTKCTVTNAFGAFPDGSTCHVA
AAAFPATEEELVRVVAGAAASGTKMKVATRLGHNFMKLSCPGGDGLVISTNALNRVVGVN
AARMEITVESGVTLSELIDAAAHAGLALPHAPYWLDLTVGGLLSTGAHGSSVSGKGGAVH
EYVTGMRVVTPAPASEGYAKVRVVNAGDPDLDAVKVSLGVLGVISQVTLALQPLFNRSVS
FRRRGDGDLAERAVAFAGEHEFGDVVWYPARGEAVFRIDDRVATTKTNTISSGDFQNVIQ
SSRSTEQQQHGDVLPFQAGISVPLSRASAFIRDAQRLLDMNPGALCGGENGGILIRYVKA
STAYLGKTEDSVEFDTTSCRHDGDAAMPEEMEQMALRKYGGVPHWGKNRNVAFDGAIAKF
PKAGEFMKVKDAYDPDGLFSSEWSDQVLGVAGAGGVNVARNGCGMEGLCVCSEDEHCSPE
KGYLCRPGMVYRDARVCRRVAGDAYADA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgcaaggttcagtaggagtccatggcatcctcctcctcgccgccgccgccgtgttgacg
cagtgtctcctcgccgccgccgttaatactccggtggtccagtgcgcgtcggggacgacg
aaatgcaccgtgaccaacgcgttcggcgcgttcccggacgggtcaacctgccacgtggcc
gccgcggcgttcccggcgacggaggaggagctcgtccgtgttgtcgccggcgcggcggcg
tcggggaccaagatgaaggtggccacgcggctcggccacaacttcatgaagctctcctgc
cccggcggcgacggcctcgtgatcagcacgaacgcgctgaaccgcgtggtgggtgtgaac
gcggcgaggatggagatcacggtggagagcggcgtgacactgtctgagctcatcgacgcc
gcggcgcacgccggcctcgctctgccgcacgcgccctactggctcgacctcaccgtcggc
ggcctcctctccaccggcgcccacggcagctcggtctccggaaagggcggcgccgtgcac
gagtacgtcaccggcatgagggtcgtcacgccggcgccggcgagcgaggggtacgcgaaa
gtccgcgtggtcaacgccggcgacccggatcttgacgcggtcaaggtctccctcggcgtc
ctcggtgtcatctcccaggtgacactcgcgttgcagccgttgttcaataggtcggtctcg
ttccgccgccgcggcgacggcgacctcgccgaacgcgccgtggcgttcgccggcgagcac
gagttcggcgacgtcgtctggtacccagcccgcggcgaggccgtgttccggatcgacgac
cgcgtcgccaccaccaaaaccaacacgatctcctccggcgatttccagaacgtcatccag
tcgtcacggtcaacggagcagcagcagcacggagacgtgttgccgttccaggccggcatc
agcgtgccgctgtcgagggcatcggcgttcatccgcgacgcgcagcggctgctcgacatg
aaccccggcgcgctctgcggcggcgagaacggcggcatcctgatccgctacgtcaaggcg
tcgacggcctacctcggcaagacggaggacagcgtcgagttcgacacgaccagctgccgc
catgacggcgacgcggcgatgccggaggagatggagcagatggcgctgcgcaagtacggc
ggcgtgccgcactgggggaagaaccggaacgtggcgttcgacggcgccattgccaaattc
cccaaagccggcgagtttatgaaggtgaaggacgcgtacgatcccgatgggctcttctcc
agtgagtggagtgaccaggtgctcggcgtcgccggcgccggtggtgtgaacgtggcgagg
aacgggtgtggaatggaggggctgtgtgtttgttcggaggacgagcattgctcgccggag
aagggatacctctgccgtccgggaatggtgtaccgtgacgcccgtgtgtgccgccgtgtc
gccggcgacgcctacgccgatgcatga

DBGET integrated database retrieval system