KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327939
Entry
4327939           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K18368  caffeoylshikimate esterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4327939
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4327939
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_2 Abhydrolase_11 Esterase Chlorophyllase2 Thioesterase Abhydrolase_3 FSH1
Other DBs
NCBI-GeneID: 4327939
NCBI-ProteinID: XP_015621826
LinkDB
Position
1:complement(28383966..28387232)
AA seq 387 aa
MAAILQPPRHAAVVAPRRAGRLARPGCAGGRRAAVAVAAAGGAARDRKPPRLEGASEELR
AAAAQCLDWAPARRRVRGAFAPVLPTLDHCLFKMAPKGIQMEENFETNSKGVEIFWKSWL
PREGTATKAALFFCHGYGDTCTFFFEGIAKRIAAAGYAVYAMDYPGFGLSYGLHGYIASF
DGMVEHVIEQYSRIKGRKEVRGLPHFLLGQSMGGAVALKVHLKQPKEWDGVLLVAPMCKI
SEDVTPPAPVLKALSILSCLLPEAKLFPQKDIGDLAFRDPSKRKVAEYNAISYTQQMRLR
TAVELLKATKDIESQLEKICSPLLILHGAADLVTDPHVSEFLYEKASTKDKTLKLYEDGY
HSILEGEPDDRISTAINDIISWLDSHC
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcggcgatcttgcagccgccgcgccacgccgcggtggtggcgccgcggcgggcgggg
aggctcgcgaggccggggtgcgcgggggggaggagggcggcggtggcggtggcggctgcc
ggcggcgccgccagggacaggaagccgccgaggctggagggcgcgagcgaggagctgagg
gccgccgcggcgcagtgcctcgactgggcccccgcgcgccgccgcgtgcgcggcgccttc
gcgcctgtgctccccaccctcgaccactgcctgttcaagatggctcccaagggaatccag
atggaagagaattttgaaaccaattcaaagggggttgagattttctggaagagttggctg
cctagggagggcactgccaccaaggcagcacttttcttctgccatggatatggtgatact
tgcactttctttttcgaagggattgcgaagagaattgcagcagcaggatatgcagtatat
gctatggattatcctggttttggtttatcatatggtcttcatggctacattgccagcttt
gatggaatggtggaacatgtcattgaacaatactcacggataaaaggcaggaaggaggtc
cgtgggctcccacattttctattgggacaatcaatgggaggtgcagtggctttgaaagta
cacctgaaacaaccaaaagaatgggatggagtgcttcttgttgcacctatgtgcaagatt
tcagaagatgttacaccaccagcgccagtgttgaaggcattgagcatattgtcatgcctt
cttccagaagcaaagttatttccacaaaaagatattggagatttggcatttagagatcca
agtaaaagaaaagtagctgagtacaatgccatttcatatacccaacaaatgaggttgagg
acagcagttgaacttttgaaggctacaaaggacatagaatcccagttggagaagatttgt
tccccattgctgattctccacggagcagcagacttggttaccgacccccatgtcagcgaa
ttcctgtacgagaaagctagcacaaaagacaagactctcaagctctacgaagatggatat
cattctatcttagagggtgaacctgatgaccggatttcaactgccattaacgacatcatt
tcatggctggattcgcactgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328684
Entry
4328684           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K18368  caffeoylshikimate esterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4328684
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4328684
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S15 DLH Peptidase_S9 FSH1
Other DBs
NCBI-GeneID: 4328684
NCBI-ProteinID: XP_015623595
UniProt: A0A0P0VG76
LinkDB
Position
2:complement(6038182..6039637)
AA seq 343 aa
MAPPPPPPTATKYFWGDSPEPDEYYASLGLRHAEAYFQSPCGRLFTHSFHPLSAASDGDV
KGVVFMSHGYGSDSSWMFQNIAISYARWGYAVFCADLLGHGRSDGVRGYLGDTEAVARAA
LSFFLSVRRSGAYASLPAFLFGESMGGATTLLAYLRSPPDAGWAGIILSAPLLVFPDDMY
PSRVRLFLYGLLFGLADTWAVMPDKRMVGRSIRDPAKLRVIASNPRLYRGSPRVGTMREL
ARVTALLRESFGEVAAPFLVVHGTDDGVTSPEGSRMLYERAASEDKSLILYDGMYHSLIQ
GESDENRDRVLADMRAWIDERVRRYGAGAGAAAADGHAEAPAA
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcgccgccaccgccgccaccgacggcgacgaagtacttctggggcgactccccggag
cccgacgagtactacgcctcgctgggtctccgccacgccgaggcctacttccagtccccc
tgcggccgcctcttcacgcactcgttccacccgctctccgccgccagcgacggcgacgtc
aagggcgtcgtcttcatgagccacggctacggctccgactcctcgtggatgttccagaac
atcgccatcagctacgcgcggtgggggtacgccgtcttctgcgccgacctgctcggacac
ggccgctccgacggcgtccgcggctacctcggcgacacggaggccgtcgcgagggcggcg
ctctccttcttcctctccgtgcggcggagcggcgcctacgcctccctcccggcgttcctc
ttcggcgagtccatgggcggcgccaccaccctgctcgcctacctccgctccccgcccgac
gccgggtgggcggggatcatcctgtcggcgccgctgctcgtcttccccgacgacatgtac
ccgtcccgcgtgcggctcttcctgtacggcctcctcttcggcctagccgacacatgggcg
gtgatgccggacaagaggatggtggggagatcgatccgcgacccggcgaagctgagggtg
atcgcgtccaacccgcggctgtaccgcggctcgccgcgggtggggacgatgcgggagctc
gcacgcgtgacggcgctgctgcgggagagcttcggggaggtggcggcgccgttcctggtg
gtgcacggcaccgacgacggggtgacctcgccggaggggtccaggatgctgtacgagcgc
gcggcgagcgaggacaagagcctcatcctctacgacgggatgtaccactcgctcatccag
ggggagtccgacgagaaccgcgaccgcgtgctcgccgacatgcgcgcctggatcgacgag
cgcgtccgccgctacggcgccggcgccggcgccgcggcggccgacggccacgccgaggcg
cccgcggcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338545
Entry
4338545           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K18368  caffeoylshikimate esterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4338545
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4338545
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_11 Peptidase_S9 BD-FAE DLH Esterase FSH1
Other DBs
NCBI-GeneID: 4338545
NCBI-ProteinID: XP_015639299
UniProt: A0A0P0WLL3
LinkDB
Position
5:17336704..17343620
AA seq 351 aa
MTKEMADDVEYHEEFVTNPRGLRLFTCGWLPASSSPKALIFLCHGYGMEVSGFMKACGVE
LATAGYGVFGIDYEGHGKSMGARCYIQKFEHLVDDCDRFFKSICELEEYRDKSRFLYGES
MGGAVALLLHRKDPTFWDGAVLVAPMCKISEKVKPHPLVVTLLTQVEEIIPKWKIVPTKD
VIDSAFKDPIKREKIRKNKLIYQDKPRLKTALELLRTSISVEQSLSQVSMPFFILHGEAD
KVTDPEVSRALYERAASADKTIKLYPGMWHGLTAGEPDHNVHLVFSDIVAWLDRRSHRQD
RASITPPAACTDSAAAAAADSPVSPEPPRQGAAGGFLCGLTGRANPQQCRM
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgacaaaggagatggccgatgatgtcgagtaccatgaggagtttgtgacgaatccgagg
gggttgcggctcttcacatgcggctggcttcctgcttcttcctcccccaaggcgctcatc
ttcctttgccatggctacggcatggaggtcagtggcttcatgaaagcatgtggggtcgag
ctggccacggcgggttacggcgtgttcggcatcgattatgaggggcatggcaagtccatg
ggtgccagatgctacatccagaagttcgagcatcttgtcgatgactgcgacagattcttc
aaatcaatatgtgagctggaggagtacagagacaagagccggttcctgtacggggagtcg
atgggcggcgcggttgcgctgctgctgcaccgcaaggacccaaccttctgggacggcgcc
gtcctcgtcgcgccgatgtgcaagatatcggagaaggtgaagccgcatccgttggtggtg
acgctcctgacgcaggtggaggagatcatccccaagtggaagatcgtccccaccaaggac
gtcatcgactctgccttcaaagaccccatcaagcgcgaaaagatcaggaagaacaagctg
atctaccaggacaagcccaggctgaagacggcgctggagctgctgcgaaccagcatcagc
gtcgagcaaagcttgtcacaggtgagcatgccgttcttcatcctgcacggcgaggccgac
aaggtgacggacccggaggtgagccgtgcgctgtacgagcgcgccgccagcgccgacaag
accatcaagctctacccggggatgtggcacggcctcaccgccggcgagccggaccacaac
gtccacctcgtcttctccgacatcgtcgcctggctcgaccgccgcagccaccgccaggac
agggcgagcattaccccgccggcggcctgcaccgacagcgccgccgccgctgcggcggac
agcccagtgtcgcctgagccgccgcggcaaggcgccgccggcggcttcctctgcggccta
accggccgagcaaatccccagcaatgtaggatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348060
Entry
4348060           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K18368  caffeoylshikimate esterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4348060
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4348060
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_11 Peptidase_S9 DLH Esterase DUF2920 Abhydrolase_3 Thioesterase FSH1
Other DBs
NCBI-GeneID: 4348060
NCBI-ProteinID: XP_015614495
UniProt: Q33B71 A0A8J8Y2K5
LinkDB
Position
10:2201497..2206783
AA seq 369 aa
MPHVQSAPAAATAAGMSAASAPAPRRWEGVDQALERMVLRACLDQAPERRRVRDAFKDVQ
LSIDHCLFKGQYSDIGTKESYEKNSRGVEIFSKCWYPENHRIKAIVCLCHGYGDTCTFFL
DGIARKIASAGYGVFALDYPGFGLSEGLHGFIPSFDTLVDDVAEHFTKVKENPEHRGLPS
FLFGQSMGGAVALKIHFKQPNEWDGAILVAPMCKIADDVIPPWPVQQVLIFMARLLPKEK
LVPQKDLAELAFKEKKKQEQCSYNVIAYKDKPRLRTALEMLRTTKEIESRLEEVSLPIII
LHGEGDLVTDPAVSKALYDKAKSSDKTLRLYKDAYHAILEGEPDEAIFQVLDDIISWLDQ
HSTKKVPSS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgccacacgtgcagtcagctcctgcggcggcgaccgcggcggggatgtccgcggcgtcg
gcgcccgcgccgaggaggtgggaaggggtggaccaggcgctggagcggatggtgctcagg
gcgtgcctcgaccaggcgcccgagcgccgccgcgtccgcgacgcgttcaaggacgtgcag
ctcagcatcgaccactgcctcttcaagggacagtatagcgatattggaacaaaggagtca
tacgagaaaaactccaggggcgtggagattttctcaaaatgttggtatccagagaatcat
cgcataaaagcaattgtttgtctctgccatggttatggagatacctgtaccttttttctc
gatggtattgctaggaagattgcttcagctggatatggagtgtttgcattagattaccct
ggttttggtctctcggaaggacttcatggatttataccaagttttgacactcttgttgat
gatgtagcagaacattttactaaggtcaaagaaaatcctgaacatagaggtcttccaagc
tttctgtttggtcaatctatgggtggagcagttgcattgaagattcattttaagcaacca
aatgaatgggatggtgcaatactagttgcgcccatgtgcaagattgcagatgatgtgatt
ccgccttggcctgttcagcaagttctaatttttatggctagacttcttccaaaagagaag
cttgttccacaaaaagatttagcagagttggctttcaaagagaagaaaaaacaggagcag
tgttcttataatgtgattgcgtacaaggataaaccacgtctccgaacagctttggagatg
ctgagaaccacaaaggaaatcgagagtcgtttggaggaggtttcgctgcccattatcatt
ttgcatggtgagggtgatttggtcacagacccagctgtgagtaaagctctctatgataaa
gcgaagagctcagataagacgcttcgcctttataaagatgcatatcacgctatcttggaa
ggtgaaccagatgaggcaatttttcaagtcctcgatgatataatttcttggctggatcag
cattctacaaagaaagttccatcgtcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351922
Entry
4351922           CDS       T01015                                 
Name
(RefSeq) caffeoylshikimate esterase
  KO
K18368  caffeoylshikimate esterase [EC:3.1.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4351922
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-
     4351922
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase AXE1 Abhydrolase_3 FSH1 BD-FAE DP
Other DBs
NCBI-GeneID: 4351922
NCBI-ProteinID: XP_015619542
UniProt: A0A8J8Y779 Q2QUI2
LinkDB
Position
12:9246619..9250365
AA seq 296 aa
MADDGFKYHEEYVTNKRGMKLFACQWSPLDHEPKALIFLCHGYAMECSISMRGTGVRLAK
AGFTVHGLDYQGHGKSEGLQGYINSFDDVVVDCSNYFASVCERGECKGKKKFLLGESMGG
AIVLMLHRKEPTNWDGAILVAPMCKIVEDMKPRPIVITILSKLSNVIPTWKIIPTEDVID
KAIKSEEWRQEVRNNPYCYKGRPRLKTGYELFMASLDIESTLDKVTLPFIIVHGGDDAVT
DPSVSEELYTSAQSKDKTLKLYPGMCHALTSGEPASNIDIVFLDIIKWLDERVSVS
NT seq 891 nt   +upstreamnt  +downstreamnt
atggcagatgatggtttcaaatatcatgaggaatatgttacaaataaacgagggatgaag
ctctttgcatgccaatggagtcctttagaccatgaaccgaaagctctaatcttcctatgc
catggatatgccatggaatgcagcatttcaatgagaggaacaggtgttcggttggcaaag
gctggatttacagtgcacggattggactatcagggccatgggaagtccgaaggacttcaa
ggctatatcaatagttttgatgatgttgttgttgattgctcgaactactttgcaagtgtt
tgtgaaagaggagagtgcaaaggaaaaaagaagttccttcttggtgagtcaatgggaggc
gctattgtgctgatgctacataggaaggaacctacaaattgggatggggctattttggtt
gcccccatgtgcaagattgtagaagatatgaagcctcgtcccattgtgataacaatccta
agcaagcttagcaacgtgatacctacatggaaaattattcctactgaagatgtcattgat
aaggcaattaaaagcgaggagtggcgtcaagaggtaagaaacaatccatattgctataaa
ggaaggcctaggttaaagactggttatgaactttttatggcaagcttggatattgaaagc
actcttgacaaggttacactaccattcatcattgtccatggtggtgatgatgccgtcaca
gatccatcagtaagtgaagaactgtatacatcagctcagagcaaggacaaaacactgaaa
ctgtacccagggatgtgtcacgccctgacatctggtgagcccgcaagcaacattgacatt
gtatttttggacatcattaagtggcttgatgagagggtatcagtttcataa

DBGET integrated database retrieval system