KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327960
Entry
4327960           CDS       T01015                                 
Name
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase, chloroplastic
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4327960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327960
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     4327960
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     4327960
SSDB
Motif
Pfam: Exo_endo_phos SAP Exo_endo_phos_2 Rho_N SAP_new25
Other DBs
NCBI-GeneID: 4327960
NCBI-ProteinID: XP_015625662
UniProt: A0A8J8Y9G5 Q5VQJ9
LinkDB
Position
1:33917383..33924617
AA seq 499 aa
MPLLLRGGSLFRLYGCGCGLPSANFSPSKLALIRLSLMMAETRATYSRRAASKNTDIKKD
DEHVLEKEDVAESKLEIEQLRNDPDRLQSMTVKELREITRMMGIPVKGNKKDLVSALMDS
LGKVGTSSVEKIGVSEVPSKRKGASVVVEQNIDSSEVISETPSKRSRAKNKGTAEESSGA
NVKQSKTSVQKKKLVVQGASVDHEEPWTVLVHKKPQPAWIPYNPKVMRSPSLSKDTKALK
ILSWNVNGLKALLKSRGFSIHQLAQREDFDILCLQETKMQEKDVEVIKEGLLEGYTHSFW
TCSVSKLGYSGTAIISRVKPLSIKYGLGVPDHDTEGRVVTVEFNDFYLLTAYVPNSGDGL
KRLTYRVTEWDPSLGNYMKDLEKSKPVILTGDLNCAHQEIDIHDPAGNRRSAGFTIEERE
SFETNFLSKGFVDTFRKQHPNVVGYSYWGYRHNARKTNKGWRLDYFLVSESIAERVHDSY
IIPDISASDHSPLGLVLKL
NT seq 1500 nt   +upstreamnt  +downstreamnt
atgccgctgctcctgcgcggcggctccctcttccgtctctacgggtgtggctgtgggctt
ccaagcgcaaatttcagtcccagcaaactagcactgataagactaagcttgatgatggca
gaaacacgagccacctattcgcgtcgagctgcctctaagaatactgatatcaagaaagat
gatgaacatgtccttgaaaaggaggatgttgctgaaagcaaattggagatagagcaactt
aggaatgaccccgatcgactccaatccatgacagtgaaggagctcagggaaatcacgagg
atgatgggaattcctgtaaaaggcaacaagaaagatttggtatcagccctgatggattct
ctgggtaaagtgggaacttcatcagttgagaagattggtgtgtctgaagtaccttcaaaa
agaaaaggtgcttcagtagtagttgaacaaaacatagatagttctgaggtcatttctgaa
actcctagtaagagaagtagagcaaagaacaaaggaaccgctgaggagagttctggggct
aatgtcaagcaaagcaagacatcagtccagaagaaaaagctagttgtccaaggtgccagt
gtggaccatgaagaaccttggactgtacttgtacacaagaaaccacaacctgcctggatt
ccttataatcctaaggtcatgaggtctccatctcttagcaaggatacgaaggctctaaag
attctgtcatggaatgtgaatggattaaaagctttacttaaatcgaggggcttctctatt
catcagttagctcagagggaggacttcgatatactatgcctacaagagacaaaaatgcag
gagaaggatgtagaagtcattaaggaaggtctacttgaaggctatacccatagtttctgg
acatgcagtgtatcaaagcttggctattcggggactgcaataatttcaagggtgaaacca
ctctctatcaagtacgggcttggtgtgccagaccatgatactgaagggagggtcgtcaca
gtggagttcaatgatttttacctcctgactgcttatgtaccaaattctggtgatggtcta
aaaagattgacttacagggtcacagaatgggatccaagccttggtaactacatgaaagac
ttggaaaaatcgaagcctgttatactaactggtgatcttaactgtgcccatcaagagatt
gatatacatgatcctgctggaaatcgtagaagtgcaggctttacaattgaagaaagggaa
tcattcgagactaattttttgtccaaaggttttgttgatacatttcgaaaacagcatccc
aatgttgttggatatagttactggggttataggcataatgcccggaagaccaacaaaggt
tggcgtctggattattttcttgtgtctgaatccattgcagaaagagtccatgattcatac
attattccagacatatctgccagtgatcacagcccgctaggcctcgtactgaagctctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327961
Entry
4327961           CDS       T01015                                 
Name
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase, chloroplastic isoform X1
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4327961
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4327961
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     4327961
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     4327961
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 COMM_domain
Other DBs
NCBI-GeneID: 4327961
NCBI-ProteinID: XP_015627423
LinkDB
Position
1:33926495..33929814
AA seq 332 aa
MSAIRASSHRLQTRTVALTRTKMSSMAGLGASQHGYPPRSHEPWTKLVHRERLPEWFAYN
PKTMRPPPLSHDTKCMKILSWNINGLHDVVTTKGFSARDLAQRENFDVLCLQETHLEEKD
VEKFKNLIADYDSYWSCSVSRLGYSGTAVISRVKPISVQYGIGIREHDHEGRVITLEFDG
FYLVNAYVPNSGRFLRRLNYRVNNWDPCFSNYVKILEKSKPVIVAGDLNCARQSIDIHNP
PAKTKSAGFTIEERESFETNFSSKGLVDTFRKQHPNAVGYTFWGENQRITNKGWRLDYFL
ASESITDKVHDSYILPDVSFSDHSPIGLVLKL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtcggcgatccgcgcctcttctcaccggctgcagacaagaactgtggcattaacaagg
acaaagatgtcaagcatggcaggcttgggagcttctcagcatggatatcctccccgaagt
catgagccctggactaaacttgtacacagagagagattacccgagtggtttgcatacaat
ccaaagaccatgaggcctccaccacttagccatgataccaagtgcatgaagattttatcc
tggaatattaacgggcttcatgatgttgtaacgacaaaggggttttctgcacgtgacttg
gctcagagagagaattttgatgtgttatgtcttcaagagacacatttggaggaaaaggat
gttgaaaagtttaagaatctgatagcagactatgacagctattggtcatgcagcgtctcg
aggcttggctattcagggactgcagtaatttcacgggttaaaccaatttctgtccaatac
gggattggcatacgtgaacatgatcatgagggcagggttattactctggagtttgatggt
ttttacttggtaaatgcctatgttccaaattctggtcgttttctacgtagactgaattac
agggtcaataactgggatccgtgtttcagcaactatgtaaaaatactggaaaagtcgaaa
ccagtgattgttgcaggagaccttaactgtgctcgtcaaagcattgacattcacaatcct
ccagcaaaaaccaagtctgcaggtttcacaattgaagagagagagtcatttgagacaaac
ttttctagcaaaggccttgtggatactttcagaaaacagcaccctaatgctgtcggctat
accttctggggtgaaaatcagcgcataaccaacaaaggttggcgattagattactttctt
gcgtcggaatctattaccgacaaggttcatgattcatacattcttcctgatgtatcattc
agcgaccacagtccaattggcctggtactgaagctatag

DBGET integrated database retrieval system