KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327999
Entry
4327999           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L9-like
  KO
K02940  large subunit ribosomal protein L9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4327999
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4327999
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4327999
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 4327999
NCBI-ProteinID: XP_015625200
UniProt: Q0E4R7 A0A0P0VDL3
LinkDB
Position
2:complement(180320..183444)
AA seq 192 aa
MKTILASETMEIPSGVTVHVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEVEGVRKLQVDA
WFGTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLG
EKKVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGI
YVSDKGTITEDQ
NT seq 579 nt   +upstreamnt  +downstreamnt
atgaagacgatcttggcttcggagacgatggagatcccgtcgggggtgacggtgcacgtg
gcggcgaaggtggtgacggtggagggtccccgtgggaagctgacgcgcaacttcaagcac
ctgaacctggacttccagctgctggaggtggagggggtgaggaagctgcaggtggacgcg
tggttcggcacccgccgcaccatggccgccatccgcaccgccatctcccacgtccagaac
ctcatcaccggcgtcaccaagggctaccgctacaagatgcgcttcgtctatgcccatttc
cccatcaacgcctccatcaccaactccaacaccgccatcgagatcaggaacttcctcggc
gagaagaaggtgaggaaagtggacatgcttgagggtgtgacaattttgcgttctgagaag
gtcaaggatgagctggtccttgatggcaatgatatcgagcttgtctcccgttctgcggca
ctgatcaaccagaaatgccacgtcaagaacaaggatatcaggaagttcctggatggcatc
tatgtcagtgacaagggcaccatcactgaggaccagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347422
Entry
4347422           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L9
  KO
K02940  large subunit ribosomal protein L9e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4347422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4347422
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4347422
SSDB
Motif
Pfam: Ribosomal_L6
Other DBs
NCBI-GeneID: 4347422
NCBI-ProteinID: XP_015612091
UniProt: P49210
LinkDB
Position
9:complement(18752426..18754227)
AA seq 190 aa
MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEGGRKLQVDAWF
GTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPINASITNSNTAIEIRNFLGEK
KVRKVDMLEGVTILRSEKVKDELVLDGNDIELVSRSAALINQKCHVKNKDIRKFLDGIYV
SDKGTITEDA
NT seq 573 nt   +upstreamnt  +downstreamnt
atgaagaccatcctggcgtccgagacgatggagatcccggagggggtgacggtgcaggtc
gccgcgaaggtggtgacggtggagggcccccgcgggaagctgacccgcaacttcaagcac
ctcaacctcgacttccagctgctggagggcggccgcaagctgcaggtggacgcgtggttc
ggcacccgccgcaccatggccgccatccgcaccgccatctcccacgtccagaacctcatc
accggcgtcaccaagggctaccgctacaagatgcgcttcgtctacgctcacttccccatc
aacgcctccatcaccaactccaacaccgccatcgagatcaggaacttcttgggcgagaag
aaggtgaggaaggttgacatgctcgagggggtgaccatcttgcggtcggagaaggtgaag
gacgagctcgtcctcgacggcaacgacatcgagctcgtctctcgctcagcagccctcatc
aaccagaaatgccacgtgaagaacaaggatatcaggaagttcttggatggtatctacgtg
agcgacaagggtaccatcacagaggatgcgtaa

DBGET integrated database retrieval system