KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328010
Entry
4328010           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328010
   00020 Citrate cycle (TCA cycle)
    4328010
   00620 Pyruvate metabolism
    4328010
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4328010
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 ACT
Other DBs
NCBI-GeneID: 4328010
NCBI-ProteinID: XP_015627700
UniProt: B9F1Q4 Q6YPG2
LinkDB
Position
2:287571..294041
AA seq 548 aa
MSAAHLLRHSRKLRTLRDALDYDRSALVRYFSAASASFPTKGGAAAGVEKRIGGARFPQC
KQPGKELETFKVSLGGLNGRYACRRAPNNCIPTTITGLNGSLSCGQVSSARSFSSSADLP
PHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKII
HGDGAKEIKVGEIIAVTVEEEGDLEKFKDYKPSTSAAPAAPSEPKAQPEPAEPKVKETEP
SRTPEPKAPKTEEASQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIEDYLA
SVAKGGKREALAAPGLSYTDVPNTQIRKVTANRLLSSKQTIPHYYLTVDARVDNLIKLRG
ELNPLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMSDFIRQYHNVNINVAVQTEHG
LFVPVIRDADKKGLGTIAEEVKQVAQRARDNSLKPEDYEGGTFTISNLGGPFGIKQFCAI
INPPQSAILAIGTAEKRVIPGSVDGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYI
ENPNSMLL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgtctgcggcgcacctcctccgccactcccgcaagctgcggactctacgtgatgctcta
gattatgatcggtctgctcttgtacgctacttctccgctgcttctgcatcctttcccaca
aagggaggtgctgctgctggtgttgagaaaagaattggtggcgccagattccctcagtgc
aagcagcctgggaaagagcttgagaccttcaaggtgtcactaggaggactaaatggaaga
tatgcttgtagaagagcacctaacaattgtatcccaaccactattaccggtctcaacggt
tcattgtcatgtggacaggtgtcttcagcaagatctttctcaagcagtgcagacctgcca
ccacatcaggaaattgggatgccatcactctctcctacaatgactgaggggaacattgca
aggtggctgaagaaggaaggagataaggtctcacctggtgaagttctctgtgaggtggag
acggataaagccactgtagagatggagtgcatggaagagggctatctcgctaagatcatt
catggagatggtgccaaagagatcaaagttggtgagatcattgctgtaactgtggaagaa
gagggtgaccttgagaagtttaaggattataaaccttcaacttcagctgcacctgcagcc
ccttctgaaccgaaggctcagcctgagcctgcagagccaaaggtgaaggagacagagcct
tccaggactcctgagccgaaagccccaaagactgaagaagcttctcaaccagggggtcga
atattctccagccctcttgcaagaaaattggcagaagataacaatgttccactgtcaagc
gtaatgggaactggtcctgatgggcgaattttgaaggcggacattgaagattacttggct
tctgtagcaaagggtggcaaaagggaagctcttgcggctccagggttaagttacactgat
gttcctaatactcagataagaaaggttactgcaaaccgcctgctaagctctaaacaaact
attcctcattattacttgacagttgacgcccgtgttgataatcttatcaagttgcgaggg
gaactgaatccgttgcaagagtcatctggcggtaagaagatatctattaacgatcttgtt
ataaaggctgcagctctggctcttcgaaaggtccctcagtgtaatagctcgtggatgagt
gattttatccgccaataccacaacgtgaacatcaatgttgctgtacagactgagcatggg
ttgtttgttccagtaattagggatgcagacaagaagggacttggtacaattgctgaggag
gtgaagcaggtggctcaaagagcaagggataacagcttaaaacctgaagattatgaggga
ggcacattcaccatatcaaacctaggaggtcctttcggaatcaaacaattctgtgccatc
ataaatcctcctcagtcagcaatcttggccattggtactgctgagaagagggtgatacct
ggcagcgtagacggccagtatgagtttggttccttcatgtcggcaacaatgagctgtgat
cacagggttattgatggtgctatcggcgcagaatttctgaaagcattcaagggctatatc
gagaatccaaactcaatgttactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339859
Entry
4339859           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339859
   00020 Citrate cycle (TCA cycle)
    4339859
   00620 Pyruvate metabolism
    4339859
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4339859
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding ACT
Other DBs
NCBI-GeneID: 4339859
NCBI-ProteinID: XP_015640863
LinkDB
Position
6:complement(370057..375051)
AA seq 567 aa
MRRCPRFAHHLRLRSQLLRLRAEASSWLRRAHAILGCERGTVVRHFSSSTCSSLVKEDTV
SSSNLHPEYAKKIGGSDFSHDRQSGKELQNFKVSPQEASRASNFMRASKYGMPITANGVH
SLFSCGQVVPSRCFSSGADLPPHQEIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEV
ETDKATVEMECMEEGYLAKIIHGDGAKEIKVGEIIAVTVEEEEDIGKFKDYKAPSSAESA
APAESKPQSEPTEPKKEKEQPKAPEPKATKTEESFLSEDRTFSSPIARKLAEDNNVPLSS
IKGTGPDGRILKADIEDYLASVAKGAKKETAAAPGLGYVDLPNTQIRKVTANRLLHSKQT
IPHYYLTVDTRVDKLIKLRSELNPLQDTSGGKKISINDLVIKAAALALRNVPECNSSWMN
DFIRQYHNVNINVAVQTEDGLFVPVIRDADKKGLATIADEVKQLAQRARDNSLKPEDYEG
GTFTVSNLGGPFGIKQFCAIVNPPQSAILAIGSAEKRVIPGAEGQFEVGSFMSATLSCDH
RVIDGAIGAEWMKAFKGYIENPTTMLL
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgcgccgatgcccccggtttgcccaccacctgcggctgcgctcgcaattgctgcgcctg
agggctgaggcttcttcttggttgcgaagagcgcatgctatcctcggatgcgagcgtggg
actgttgttcgtcacttctcatccagcacttgctcctctcttgtaaaggaagatactgta
tcaagttccaaccttcatccagagtatgcaaaaaaaattggaggatcagatttttcccat
gacaggcagtctggaaaagagcttcagaatttcaaggtctcaccgcaagaagcaagtaga
gcctccaatttcatgagagcatccaaatatggaatgccaattactgctaatggggtacat
agtttgttctcatgtgggcaggtagtaccgtctaggtgtttttcaagtggagcagatttg
cctccacatcaggaaatcggaatgccttcactctcccctaccatgactgagggaaacatt
gcaaggtgggtgaagaaagaaggagataaagtctcacctggtgaagttctttgtgaagta
gagactgataaagcgacagtggagatggaatgcatggaggaaggctaccttgctaaaatt
atccatggagatggtgccaaagaaattaaagttggtgagattattgccgtaaccgtggaa
gaagaggaagacatcggcaaatttaaggattataaggctccatcatctgctgaatctgca
gctccagccgaatcgaagccccaatctgagcccacagaaccaaaaaaggagaaagagcag
cccaaggctcctgagccaaaggctacaaagacagaagaatcttttctttcagaggatcgc
acattctccagtccaattgcaaggaaattggcagaagacaacaatgtaccactgtcaagc
ataaaaggtactggccccgatgggcgaattttgaaggcagatattgaggattacttggct
tctgtggccaagggtgccaagaaggaaacagcagcagctcctggactaggctatgtggat
cttcctaatacgcaaataaggaaggttactgcaaaccgcctgctgcactccaagcaaacc
attcctcactactatctgacagttgatactcgtgttgacaaacttattaagttgcgaagt
gagttgaatcctctgcaggatacctctggtggcaagaagatatccataaatgatcttgtt
atcaaggccgcagcattggctcttcgtaatgttcctgagtgtaatagctcttggatgaat
gattttattcgccaataccacaatgtgaacatcaatgttgctgtacaaactgaggatggc
ttgtttgttcccgtaataagggatgctgacaagaagggcctagccactatcgctgatgag
gtgaagcaactggctcagagagcaagggacaacagccttaagccagaggattatgagggt
ggcactttcactgtgtcaaacttgggaggcccttttggaattaagcaattctgtgccatc
gtaaatcctccacaatcagcaattttggctattggctcagctgagaagagggtgatccct
ggagctgagggtcagtttgaagttggttcgtttatgtcagcaacattgagctgcgaccac
cgggtcattgacggtgccattggtgcagaatggatgaaggcgttcaagggctacatcgag
aatccaacgaccatgttgctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341113
Entry
4341113           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 1 of pyruvate dehydrogenase complex, mitochondrial
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4341113
   00020 Citrate cycle (TCA cycle)
    4341113
   00620 Pyruvate metabolism
    4341113
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4341113
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Other DBs
NCBI-GeneID: 4341113
NCBI-ProteinID: XP_015643505
UniProt: Q654L9 Q0DC04
LinkDB
Position
6:complement(17597802..17609665)
AA seq 484 aa
MANIRALLIGLVRARGSLVDIGRCVSSSRPSYLASLGRHYKVPMEIRWLSSTGFPPHLVV
GMPALSPTMNQGNIAKWRKQEGEKIEVGDVICEIETDKATLEFESLEEGYLAKILAPEGS
KDVQVGQPIAVTVEDLEDIKNIPADASFGGEQKEQSIASEAQKVETDAAKESSIITRISP
AAKLLIKEHRLDQSVLNASGPRGTLLKGDVLAALKLGASSSSTKQKNAPAAPSSQPTHDF
QAQSVTIPQQNDAYEDIPNSQIRKVIAKRLLESKQTTPHLYLSQDVILDPLLAFRNELKE
QHGVKVSVNDIVIKAVALALRNVPEANAYWNNDKEQAQKCVSVDISIAVATEKGLMTPII
RNADQKTISAISSEVKQLAEKARAGKLAPNEFQGGTFSISNLGMYPVDHFCAIINPPQSG
ILAVGRGNKIIEPVVDSDGTEKATVVTKMSLTLSADHRVFDGQVGGKFFTELSQNFGDIR
RLLL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgaacattcgggctcttctcatcgggttggtacgtgccaggggttccttggtggac
attgggcgatgcgtttcttcttcaaggccttcatatctagcgtcactgggcagacattac
aaggttcccatggaaattcgttggttatcctcaacagggtttcctcctcatctggtggtt
gggatgcctgcattatcccctactatgaatcaaggtaacattgcaaaatggagaaaacaa
gaaggtgaaaagatagaagttggtgatgtgatctgtgagatagaaactgacaaagctacg
cttgagtttgagagccttgaagaggggtatctggccaagatcttagcacctgaaggttca
aaagatgttcaggttggacagcccattgctgtcacggttgaagatcttgaggatattaaa
aatatacctgctgatgcttcctttggaggtgaacagaaagagcagtcaattgcaagtgaa
gcacaaaaggttgaaacggatgctgcaaaagagagctcgataataacccgtataagcccg
gcagcaaaattgcttatcaaggagcatcgtctagatcagtctgtactgaatgcatcgggt
ccccgtggcactcttctgaaaggggacgttcttgctgcattgaagttgggtgcctcctca
agttcaaccaagcaaaagaatgctccagctgcaccatcatctcagccaactcatgatttc
caagctcaatcagtcaccattccacaacaaaatgatgcatacgaagatatccccaacagt
cagatacgcaaggtgattgcaaaaaggttgcttgaatcaaagcagaccactccacattta
tatttatcacaagatgttatactggatcccttgctcgctttcaggaatgaactgaaagag
caacatggggttaaagtttcagtaaatgacattgtcataaaggctgttgcacttgcctta
cggaatgtaccagaagcaaatgcatactggaacaatgacaaggaacaagcccagaagtgt
gtttcagttgatatatctatcgcagttgctacagagaagggcctgatgactcctattata
agaaatgcagatcaaaagactatatcagcaatatcctcagaggttaagcagttggctgaa
aaggcacgtgctgggaagcttgctcctaatgaatttcagggagggactttcagcatctca
aatttgggaatgtacccagtcgaccacttctgtgcaatcatcaatcctcctcagtctgga
attcttgctgttgggcgtggtaataagattatcgagcctgtggtggacagtgatggaacc
gagaaggctacagtggttacaaaaatgagcttgacattgtccgctgaccatcgtgtattt
gatggtcaagtaggaggcaagtttttcacagagttgtcacagaattttggtgacattagg
agactgctattgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343003
Entry
4343003           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 2 of pyruvate dehydrogenase complex, mitochondrial isoform X1
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4343003
   00020 Citrate cycle (TCA cycle)
    4343003
   00620 Pyruvate metabolism
    4343003
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4343003
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HTH_Tnp_Tc5
Other DBs
NCBI-GeneID: 4343003
NCBI-ProteinID: XP_015647684
LinkDB
Position
7:complement(12811694..12819399)
AA seq 547 aa
MSAAHLLRHSRKLRSLHNALDCERSGLVRYFSTASGSFPTKGNVLLVSTGAEKRIGGARF
PQRKQPGKELETSKLSLGLNGSYTCRRSPNNFIPNTITGLNGSLSCGQIASARSFSSSAD
LPPHQEIGMPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAK
IIHGDGSKEIKVGEIIAVTVEEEGDIKKFKDYKPSTLAAPVAPSELKAQSEPTEPKVEER
EPSKASELKAPRTEEPSRSGDRIFSSPLARKLAEDNNVPLSSVKGTGPDGRILKADIEDY
LAKGCRKEALAAPGLSYTDVPNAQIRKVTANRLLSSKQTIPHYYLTVDTRVDNLIKLRGE
LNPLQESSGGKKISINDLVIKAAALALRKVPQCNSSWMNDFIRQYHNVNINVAVQTEHGL
FVPVIRDADKKGLGMIAEEVKQLAQRARDNSLKPDDYEGGTFTISNLGGPFGIKQFCAII
NPPQSAILAIGSAERRVIPGSANGQYEFGSFMSATMSCDHRVIDGAIGAEFLKAFKGYIE
NPTSMLL
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgtccgccgcgcatctcctccgccactctcgcaagttgcggagtttacacaatgctcta
gactgtgagcgttctggcctcgtgcgctacttctccactgcttctggttcgttccccacc
aagggaaatgtgcttttggtttccacaggtgctgagaaaagaattggaggtgccagattt
cctcagcgcaagcaacctggaaaagagcttgagacctccaagttgtcactaggacttaat
ggaagctacacttgcaggagatcacctaacaactttatcccaaatactattactggtctc
aatggttcattgtcatgtggacagatagcttcagcaagatctttctcaagcagtgcagac
ctgccaccacatcaggaaatagggatgccatcactctctcctacaatgaccgaggggaac
attgcaaggtggctgaagaaggaaggagataaggtctcacctggtgaagttctttgtgag
gtggagactgataaagccaccgtagaaatggagtgcatggaagagggctatcttgctaag
atcattcatggagatggttccaaagagatcaaagttggtgagattattgctgtaaccgtg
gaagaagagggtgacatcaagaagtttaaggattataaaccttcaactttggctgcacct
gtagccccttctgaactgaaggctcagtctgagcctacagaaccaaaggtggaggaaaga
gagccttccaaagcatctgagctaaaggccccaaggactgaagaaccttcgcggtcagga
gatcgaatattctccagccctcttgctagaaaattggcggaagataacaatgttccactg
tcgagtgtaaagggaactggtcctgatgggcgcattttgaaggcagacattgaagattac
ttggctaagggttgcagaaaggaagctcttgcggctccagggctaagttacaccgatgtt
cccaatgcacaaataagaaaggttactgcgaaccgcctgctaagctctaagcaaacaatt
ccacattattacctgacagttgacacacgtgttgataatctcatcaagttgcgaggggaa
ctgaatccattgcaggagtcctccggtggtaagaagatatctattaatgatctagttata
aaggctgcagctctggctcttcgaaaggtccctcagtgtaatagctcctggatgaatgat
tttatccgccaataccacaacgtgaacatcaatgttgctgtacagactgagcatggactg
tttgttccagtaatcagggatgcagacaagaaaggacttggtatgattgcggaggaggtg
aagcagttggctcaaagagcaagggataacagtttgaaaccagatgattatgagggaggc
acattcaccatatcaaacttgggaggtccttttggaattaagcaattttgtgccatcata
aatcctcctcagtcggcaatcttggccattggttctgctgagaggagggtgatacctggc
agcgccaatggtcaatacgagtttggttccttcatgtcggcaacaatgagctgtgatcac
agggttattgatggtgcaatcggggcagaatttctgaaagcattcaagggctatatcgag
aatccaacctcaatgttactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345640
Entry
4345640           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4345640
   00020 Citrate cycle (TCA cycle)
    4345640
   00620 Pyruvate metabolism
    4345640
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4345640
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PASTA
Other DBs
NCBI-GeneID: 4345640
NCBI-ProteinID: XP_015650015
UniProt: Q0J5I9 Q6ZKB1
LinkDB
Position
8:complement(20858745..20862276)
AA seq 475 aa
MATTPAPVSLSAAASTVPARLLVGRGAAAAPVARRRARMVVVRAKIREIFMPALSSTMTE
GKIVSWSAAEGDRVAKGDAVVVVESDKADMDVETFHDGIVAAVLVPAGESAPVGAPIALL
AESEDDLQAALAKAQELSKAHPQQAPPPSDAAAPPPPPPPPAAAPAAPAPVAAGTKGIAT
PQAKKLAKQHRVDLAKVAGTGPFGRITPADVEAAAGIEPKPKVVPAASAAPVPLSAPAIG
AVPQAAELPPVPGATVVPFTGMQAAVSKNMVESLAVPAFRVGYPIVTDKLDELYEKVKSK
GVTMTVLLAKAAAMALAQHPVVNASCRDGKSFTYNTNINIAVAVAIDGGLITPVLEDADK
LDIYLLSQKWKELVKKARAKQLQPNEYSSGTFTLSNLGMFGVDRFDAILPPGQGGIMAVG
ASKPTVVADKDGFFSVKSKMLVNVTADHRIVYGADLAAFLQTFAKIIEDPESLTL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcgacgactccagcgcccgtctcgctctcggccgcggcctccaccgtgccggcgcgc
ctcctcgtggggcggggcgccgcggcggcgccggtggcgaggcggcgggcgaggatggtg
gtggtgcgggccaagatccgggagatcttcatgccggcgctgagctccaccatgacggaa
gggaagatcgtgtcgtggtcggccgccgagggggaccgcgtcgccaagggggacgccgtg
gtggtcgtcgagtccgacaaggccgacatggacgtcgagacgttccacgacggcatcgtc
gccgccgtcctcgtccccgccggtgagtccgcccccgtcggcgcccccatcgcgctgctc
gccgagtccgaggacgacctccaggccgccctcgccaaggcccaggagctctccaaggcc
cacccgcagcaggcgcctccaccctccgatgccgccgcgccgccaccgccgcctcctcca
cccgcggccgctccggcggctccggcgccggtggcagccggcacgaagggcattgccacc
ccgcaagctaagaagctggccaagcagcatagggtggacctagctaaggtggctggcact
gggccgttcgggcgaattacgccggccgatgttgaggctgccgccggcatcgagccgaag
ccgaaggttgtgcctgctgcttctgctgctcccgtgccgctgtctgctccggcaattggc
gccgtgccacaggccgcggagcttcctccggtgcccggtgccacggtggttccattcact
ggcatgcaggctgcagtgagcaagaacatggtggagagcctcgcggtgcccgcattccgt
gtgggatacccaattgtgaccgataagctcgatgagctatatgagaaggtcaagtcaaag
ggggtgaccatgacagttctgctggcgaaggccgcagctatggcacttgcgcagcacccg
gtggtgaatgctagctgcagggatgggaagagcttcacttacaacaccaacatcaacatc
gcggtggctgtcgcaatcgatggtgggctcattacacctgttctggaggatgctgataag
ttggatatatatttgctctcacaaaaatggaaggaactagtcaagaaagctcgtgcaaaa
cagctccaaccaaatgagtacagctctgggacatttacactgtcaaacttgggtatgttt
ggtgttgatagatttgatgcaattcttccacctggccagggaggcataatggctgtcgga
gcctcaaaacctacagtggtggctgataaagatggtttctttagtgtcaagagcaaaatg
ctggttaatgtcactgctgatcacagaattgtatacggtgctgatctggcagcattcctg
caaacttttgcaaagattattgaggatcctgagagcttaactttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347022
Entry
4347022           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4347022
   00020 Citrate cycle (TCA cycle)
    4347022
   00620 Pyruvate metabolism
    4347022
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4347022
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118
Other DBs
NCBI-GeneID: 4347022
NCBI-ProteinID: XP_015651158
UniProt: Q0J1V9 Q69N33
LinkDB
Position
9:complement(14454749..14457651)
AA seq 501 aa
MLLPPLVVGSTMASLASLSLPVSTASQGRARGAGPVTAAPRRRRVSVVRAKVREIFMPAL
SSTMTEGRIVSWTAAEGDRVAKGDPVVVVESDKADMDVETFYDGIVAVVLVPAGESAPVG
APIALLAESEEEVAVAQARAQALPRGPGQEPPPPHVPKAAPPPPPPPPPHAPPGPPPTKG
VATPHAKKLAKQHRVDISMVVGTGPHGRVTGADVEAAAGIKPKLKGPKGAPPPPPPPPPS
PHRHPAAHPPPPPHHPAPRPPPPMAAAPRQPAALPPVPGATVVPFTTMQAAVSRNMMESL
SVPTFRVGYAVCTDKLDALCEKVKSKGVTKTLLLVKAAAMALTQHPVVNASCRDGKSFSY
NSSINIAVAVAIEGGLLTPVLEDVDKLDVYLLAQKWRGLLKKARMKQLQPDEYSSGTFTL
SNLGMFGVDRFDAILPPGQGAIMAVGGSRPTLVANKDGFFSIKNEMLVNVTADHRIIYGA
DLAAFLQTFAKIIEDPESLTL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgctcctcccccctctggtggtcggctcgaccatggcgtcgctggcgtccctctcgctc
ccggtctccaccgcctcgcagggccgcgcgcgcggcgcgggacccgtcacggcggcgccg
cggcggcggagggtgagcgtcgtgcgggcgaaggtgcgggagatcttcatgccggcgctg
agctcgacgatgacggaggggaggatcgtctcctggacggcggcggagggggaccgcgtc
gccaagggggaccccgtggtggtggtggagtccgacaaggcggacatggacgtggagacc
ttctacgacgggatcgtcgccgtcgtcctcgtcccggccggtgagtccgcccccgtcggc
gcccccatcgccctcctggcggagtccgaggaggaggtcgccgtcgcgcaggcgcgtgca
caggctctcccgagaggcccgggccaagaaccccctcctccccacgttcccaaggctgcg
ccgccgccgccgccgccaccaccaccacatgcccctcctggaccgccgccgacgaagggc
gtcgccacgccgcacgccaagaagctagcgaagcagcacagggtggacatctccatggtc
gtcggcaccgggccacacggccgcgtcaccggagccgacgtcgaggcggccgctggcatc
aagccaaagctaaagggcccaaagggcgctccacctccgcctccgcctccacctccatcg
ccacacagacaccccgctgctcaccctccgcctccgcctcaccaccccgctcctcgccct
ccgccgccgatggcggcggcaccccggcaaccagcagcgctgccaccggtgcctggcgcg
acggtggtgccgttcacgacgatgcaagccgcggtgagcaggaacatgatggagagcctg
tcagtgccaacattcagagtcggctacgccgtgtgcactgacaagctcgacgcactatgc
gagaaggttaaatcgaaaggggtcacaaagacattgttgctggtgaaggccgcggccatg
gcgctcacgcagcacccggttgtgaatgccagctgcagggatgggaagagcttcagttac
aacagtagtatcaacattgctgtggctgtcgcgatcgagggcggccttcttacgcctgtc
ttggaggatgttgataagttggatgtataccttcttgcacaaaagtggagaggcctgctc
aagaaggcacgcatgaagcagctccaaccagacgaatacagttcagggacttttacgctg
tctaatttgggtatgtttggtgtggatagattcgatgcaatccttccacctggtcagggg
gctattatggctgttggaggatcgagacctactttggtggccaacaaagatggtttcttt
agcatcaagaacgaaatgctggtcaatgttactgctgaccacaggattatatatggtgct
gatttggcagcattcctgcagacatttgcgaagatcattgaggatcctgagagcctaaca
ttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351678
Entry
4351678           CDS       T01015                                 
Name
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00020  Citrate cycle (TCA cycle)
osa00620  Pyruvate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4351678
   00020 Citrate cycle (TCA cycle)
    4351678
   00620 Pyruvate metabolism
    4351678
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     4351678
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Other DBs
NCBI-GeneID: 4351678
NCBI-ProteinID: XP_015618112
UniProt: Q2QWU7 A0A5S6R8X8
LinkDB
Position
12:complement(4171991..4176902)
AA seq 467 aa
MAALLHLQSSATAAAAPSFLLLRRRGGGVTAPAGSSRRRRACFRVEAKIREIFMPALSST
MTEGKIVSWTASEGDRLAKGDPVVVVESDKADMDVETFHDGFLAAVLVPAGESAPVGSAI
ALLAESEDEIPAAQSKAASLSSSSSSSPPPPPPQESTPPPPPPPPPAPVAAAVSAPAPPS
PASQGGLRVVASPYARKLAKDLNVDLNSITGSGPGGRIVAKDVEAAAAAPKKAAPVAAAR
PDVPLGSTVPFTTMQGAVSKNMVESLAVPTFRVGYTFTTDALDALYKKIKPKGVTMSALL
AKATAMALVQHPVINSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLPDADKLDIYSLSR
KWKELVDKARAKQLQPHEYNSGTFTISNLGMFGVDRFDAILPPGTGAIMAVGSSQPTLVG
TKDGSIGIKNQMQVNVTADHRVIYGADLAAFLQTLSKIIEDPKDLTF
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccgccctcctccacctccagtcctccgccaccgccgccgcggcgccctccttcctc
ctcctccgccgccgcggcggcggcgtcacggcgccggcagggagcagccggcggcggcgg
gcgtgcttccgcgtggaggcgaagatccgggagatcttcatgccggcgctgagctcgacc
atgacggaggggaagatcgtgtcgtggacggcctccgagggggaccgcctcgccaagggc
gaccccgtcgtcgtcgtcgagtccgacaaggccgacatggacgtcgagaccttccacgac
ggcttcctcgccgccgtcctcgtccccgccggcgagtccgcccccgtcggctccgccatc
gcgctcctcgccgagtccgaggacgagatccccgccgcccagtccaaggccgcctccctc
tcctcctcctcctcctcctctccaccacctccgcctccccaagaatcaacccctccccct
cccccgccacctcctccagcgccagtagcagcagcagtctccgctcccgcgcctccatcc
ccagcctcgcaaggcggcttgcgcgtggtcgcgtcgccgtacgccaggaagctagccaag
gacctcaacgtcgatctcaactccattaccggctctggccctggcgggcggatagtggcc
aaggacgtcgaggcggcggcggctgcgccaaagaaggcggcgcccgtggcggctgctcgg
cccgatgtgccgctgggttcgacggtgccattcacgacaatgcagggtgccgtcagcaag
aacatggtggagagcctcgccgtgccgacgttcagagtcggttacaccttcacaaccgat
gctctggatgcactctacaagaagattaagccgaagggtgtgacaatgtcggccctgttg
gcgaaggcgactgcaatggcgctcgtgcaacacccggttataaactccagctgcagagat
gggaagagcttcacttacaacagcagcataaacatcgctgtggcagtggccatcgatggt
gggttgattacgccagtgcttcctgatgctgataagctcgacatttattctttgtcgagg
aaatggaaggagttagtcgataaggctcgagcgaagcagctacagccccatgaatacaat
tctggcacctttactatttcaaaccttggtatgtttggagttgacagatttgatgcaatc
ttgccacctggaactggtgcaatcatggccgttggatcatcacaaccaacacttgttggt
acaaaagatggtagtattgggatcaagaaccaaatgcaggtcaatgttactgctgatcat
cgggttatttacggagctgatcttgccgcttttctgcaaactctttccaagataattgag
gatcccaaggaccttacattttag

DBGET integrated database retrieval system