KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328012
Entry
4328012           CDS       T01015                                 
Name
(RefSeq) L-lactate dehydrogenase A
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328012
   00620 Pyruvate metabolism
    4328012
   00640 Propanoate metabolism
    4328012
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4328012
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328012
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     4328012
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4328012
  Exosomal proteins of breast milk
   4328012
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4 Pyr_redox_2 F420_oxidored Sacchrp_dh_NADP NAD_Gly3P_dh_N PglD_N TrkA_N 3HCDH_N
Other DBs
NCBI-GeneID: 4328012
NCBI-ProteinID: XP_015626150
UniProt: Q0E4Q5 A0A0P0VDN6
LinkDB
Position
2:295307..299168
AA seq 392 aa
MSHKTTIDHFHFHFQERSTSPLAFHPVSEGGRSRSRSRDMKKASSLSELGFDAEGASSGF
FRPVADGGSTPTSHRRRLTKISVIGAGNVGMAIAQTILTRDMADEIALVDAVPDKLRGEM
LDLQHAAAFLPRVRLVSDTDLAVTRGSDLAIVTAGARQIPGESRLNLLQRNVALFRKIVP
ALAEHSPEALLLIVSNPVDVLTYVAWKLSGFPASRVIGSGTNLDSSRFRFLLAEHLQVNA
QDVQAYMVGEHGDSSVAIWSSMSVAGMPVLKSLRESHQSFDEEALEGIRRAVVDSAYEVI
SLKGYTSWAIGYSVASLAASLLRDQHRIHPVSVLASGFHGIPQDHEVFLSLPARLGRAGV
LGVAEMELTEEEARRLRRSAKTLWENCQLLDL
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagccacaaaaccaccatcgatcatttccatttccattttcaggagagatccacatcg
ccgttggcctttcatccagtgagtgagggagggagatctcgatctcggtctcgcgacatg
aagaaggcttcgtctctgtcggagctggggttcgacgcggagggcgcgtcgtcggggttc
ttccgtccggtggcggacggcgggtcgacgccgacgtcgcaccggcgtcggctgacgaag
atatcggtgatcggcgcgggcaacgtggggatggcgatcgcgcagaccatcctgacccgg
gacatggcggacgagatcgcgctggtggacgcggtgccggacaagctgcgcggggagatg
ctggacctgcagcacgcggcggcgttcctcccccgcgtccgcctcgtctccgacaccgac
ctggccgtcacgcgcggctccgacctggccatcgtcacggccggcgcgcgccagatcccc
ggggagagccgcctgaacctgctgcagcggaacgtggcgctgttccggaagatcgtgccg
gcgctggcggagcactcgccggaggcgctgctgctgatcgtctccaaccccgtcgacgtg
ctgacgtacgtggcgtggaagctgtcggggttcccggcgagccgcgtcatcggctccggc
accaacctcgactcctccaggttccgcttcctcctcgccgagcacctccaggtcaacgcc
caggatgtccaggcgtacatggtgggagagcacggggacagctcggtggcgatatggtcg
agcatgagcgtggccgggatgccggtgctcaagtcgctgcgggagagccaccagagcttc
gacgaggaggccctggagggaatccggcgagcggtggtggacagcgcgtacgaggtgatc
agcctcaagggctacacctcctgggccatcggctactccgtcgccagcctcgccgcctcc
ctcctccgcgaccagcaccgcatccaccccgtctccgtcctcgcctccggcttccacggc
atcccccaagaccacgaggtcttcctcagcctccccgcccgcctcggccgcgccggcgtc
ctcggcgtcgccgagatggagctcaccgaggaggaggcccgccgcctccgccgctccgcc
aagacgctctgggagaactgccagctgctcgacctctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339856
Entry
4339856           CDS       T01015                                 
Name
(RefSeq) L-lactate dehydrogenase B
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00270  Cysteine and methionine metabolism
osa00620  Pyruvate metabolism
osa00640  Propanoate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4339856
   00620 Pyruvate metabolism
    4339856
   00640 Propanoate metabolism
    4339856
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4339856
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4339856
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     4339856
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4339856
  Exosomal proteins of breast milk
   4339856
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C F420_oxidored TrkA_N Pyr_redox_2 Sacchrp_dh_NADP NAD_Gly3P_dh_N PglD_N Glyco_hydro_4 3Beta_HSD Tail_P2_I
Other DBs
NCBI-GeneID: 4339856
NCBI-ProteinID: XP_015642578
UniProt: A0A0P0WRP1 Q9LWZ6
LinkDB
Position
6:complement(347006..348527)
AA seq 360 aa
MKKASSLSELGFDADGPSFFRHLTLTDGDDGTLPRRRLIKISVIGAGNVGMAIAQTILTQ
DLADEIVLIDAVADKVRGEMLDLQHAAAFLPRVNIVSGTEVSLTRSSDLVIVTAGARQIP
GETRLNLLQRNVSLFRKIVPAAAEASPESVLVIVSNPVDVLTYVAWKLSGFPASRVIGSG
TNLDSSRFRFLLAEHLEVSAQDVQAYMVGEHGDSSVALWSSISVGGMPVLAHLQKNHRSA
ATAKKFDEAALEGIRRAVVGSAYEVIKLKGYTSWAIGYSVASIAWSLLRDQRRIHPVSVL
AKGLVRGVPADRELFLSLPARLGRAGVLGVAAELVLTDEEERRLRISAETLWGYCHALGL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaagaaggcgtcgtcgctgtctgagctggggttcgacgccgatggcccgtcattcttc
cggcacctgacgctgaccgatggcgacgacggcacgctgccccggcggcggctgatcaag
atctcggtgatcggcgcgggcaacgtgggcatggccatcgcgcagacgatcctgacgcag
gacctcgccgacgagatcgtgctgatcgacgcggtggcggacaaggtgcggggcgagatg
ctggacctgcagcacgcggcggcgttcctcccccgcgtgaacatcgtgtccggcacggag
gtgtcgctgacgaggagctcggacctggtgatcgtgacggcgggggctcggcagatcccg
ggggagacgcggctgaacctgctgcagcggaacgtgtcgctgttccggaagatcgtgccg
gcggcggcggaggcgtcgccggagtcggtgctggtgatcgtgtcgaacccggtggacgtg
ctgacgtacgtggcgtggaagctgtcggggttcccggcgagcagggtgatcgggtcgggg
acgaacctggactcgtctcggttcaggttcctcctcgccgagcacctggaggtgagcgcg
caggacgtgcaggcgtacatggtgggggagcacggggacagctcggtggcgctgtggtcg
agcatcagcgtgggggggatgccggtgctggcgcacctgcagaagaaccaccggtcggcg
gcgacggcgaagaagttcgacgaggcggcgctggaggggatccggcgggcggtggtgggg
agcgcgtacgaggtgatcaagctcaaggggtacacgtcgtgggccatcggctactccgtc
gccagcatcgcctggtcgctgctccgtgaccagcgccgcatccacccggtctccgtcctc
gccaagggccttgtccgtggcgtccccgccgaccgcgagctcttcctcagcctgcccgct
cgcctcggccgcgccggcgtgcttggcgtcgccgccgagctggtgctcaccgacgaggag
gagaggaggcttcgcatctccgccgaaaccctctggggatactgccacgccctcggcctc
taa

DBGET integrated database retrieval system