KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328048
Entry
4328048           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L37-1
  KO
K02922  large subunit ribosomal protein L37e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328048
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328048
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4328048
  Archaea
    4328048
SSDB
Motif
Pfam: Ribosomal_L37e DZR_2 DZR SelR DUF3839
Other DBs
NCBI-GeneID: 4328048
NCBI-ProteinID: XP_015626988
UniProt: A0A0P0VE24 Q6Z8Y5
LinkDB
Position
2:633488..635833
AA seq 94 aa
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG
TGRMRYMRHVPRRFKSNFREGTEATPRKRAAAAN
NT seq 285 nt   +upstreamnt  +downstreamnt
atggggaagggtacgggcagcttcggcaagcgccggaacaagacgcacacgctctgcgtc
cgctgcggccgccgcagcttccacctccagaagagcacctgctcctcctgcggctacccc
gccgcccgcatccgcaagtacaactggagcgtgaaggccattaggcgcaagaccacagga
actggaaggatgaggtacatgcgacatgtgcctaggaggttcaagagcaacttcagagaa
ggtactgaggctaccccaaggaagagagctgccgcagccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344579
Entry
4344579           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L37-1
  KO
K02922  large subunit ribosomal protein L37e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4344579
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4344579
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4344579
  Archaea
    4344579
SSDB
Motif
Pfam: Ribosomal_L37e DZR_2 DZR SelR DUF3839
Other DBs
NCBI-GeneID: 4344579
NCBI-ProteinID: XP_015648298
UniProt: A0A5S6R728 Q0J889
LinkDB
Position
8:1619128..1621401
AA seq 94 aa
MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG
TGRMRYMRHVPRRFKSNFREGTEATPRKRAAVAN
NT seq 285 nt   +upstreamnt  +downstreamnt
atgggtaagggtacgggcagcttcggcaagcgccggaacaagacgcacacgctctgcgtc
cgctgcggccgccgcagcttccacctccagaagagcacctgctcctcctgcggttacccc
gccgcccgcatccgcaagtacaactggagcgtgaaggccattaggcgcaagaccacagga
accggaaggatgaggtacatgcgacatgtgcctaggaggttcaagagcaacttcagagaa
ggtactgaggctaccccaaggaagagagctgccgtggccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267955
Entry
9267955           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L37-3
  KO
K02922  large subunit ribosomal protein L37e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9267955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9267955
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    9267955
  Archaea
    9267955
SSDB
Motif
Pfam: Ribosomal_L37e DZR_2 DZR SelR DUF3839
Other DBs
NCBI-GeneID: 9267955
NCBI-ProteinID: XP_015625816
UniProt: A0A0P0VR59
LinkDB
Position
2:34918050..34919891
AA seq 141 aa
MLFHSKAYMLVGLDLLTKPNLEQLRSLLLPHLPRRRRRRQAKEKAKMGKGTGSFGKRRNK
THTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTGTGRMRYLRHVPKRF
KSNFREGTEAAPRKKGAAASN
NT seq 426 nt   +upstreamnt  +downstreamnt
atgctttttcattcgaaggcctatatgttagttgggcttgacctccttactaaacctaac
ctcgagcagttgcgctctctccttcttcctcatctccctcggcggcggcggcggcggcaa
gcgaaggagaaggcgaaaatgggcaagggcacggggagcttcgggaagcgccggaacaag
acgcacacgctctgcgtgcgctgcggccgccgcagcttccacctgcagaagagcacctgc
tcctcctgcggctaccccgcggcccgcatccgcaagtacaactggagtgtgaaggccatc
aggaggaagaccactggaactgggaggatgaggtaccttcgccacgtgcccaagaggttc
aagagtaacttcagagaggggactgaggctgcaccaaggaagaagggggctgctgctagc
aactag

DBGET integrated database retrieval system