KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328053
Entry
4328053           CDS       T01015                                 
Name
(RefSeq) probable gamma-aminobutyrate transaminase 4
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4328053
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4328053
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     4328053
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4328053
NCBI-ProteinID: XP_015624768
UniProt: Q6ZH29
LinkDB
Position
2:complement(679392..697344)
AA seq 483 aa
MTTPHGLLQYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCY
VYDVNGTKYLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKEL
ISMFTAREMGKVFFTNSGSEANDSQVKIVWYYNNALGRPKKKNIISRTQSYHGTTFISAS
LSGLPTLHQDFDLPGRFVLHTDCPHYWRFHLPGETEEEFATRLADNLENLILKQGPETIA
AFIAEPVIGAGGVILPPKTYFEKIQAVVKKYDILFIVDEVITGFGRLGTMFGSDLYNIKP
DLVSLAKALSSAYAPIGAILVSPEISDVIHSHSNKLGTFAHGFTYSGHPVSCAVALEALK
IYRERDIPGHVTHVAQRFQEGIKAFAAGSPIVGETRGVGLLIATEFTDNKSPYELFPFEW
GVGEIFGQECKKRGMMVKVLGNLIAMSPPLIITREEIDKLVSIYGEALKATEERVAELKS
KKN
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgacgactcctcatggcctcctccagtactcatcaggtgccttctctgatcaggtgcca
gctgatgactctgctgaagaacatggggttaaggatcatgccatgcttgcaccgtttaca
gccgcatggcagaccgctatctcaccaccactggttattgagagatctgagggatgttac
gtttacgatgtcaacgggaccaagtatctagatgcacttgcaggattgttgtctacagct
ttaggtggtagtgagcctcgtttagtcaaagctgctacggagcaattaaacaagttaccc
ttctaccactccttttggaaccatacaaccaggccttctttggatcttgcgaaagaactt
attagcatgtttactgccagggaaatgggcaaagtgttctttacgaacagtggttcagaa
gcaaatgactctcaggttaagatagtatggtattataacaatgcattggggaggccaaag
aagaaaaatatcatttcacggacacaatcatatcatggaacaacattcatatcagctagt
ctatcaggtcttcctaccttgcatcaggattttgatctgccaggacgttttgttctgcac
acagactgccctcactactggcgcttccatctccctggtgagacagaagaagaatttgca
actagacttgccgataatttagagaatcttatcctcaaacaaggaccagaaacgatcgct
gccttcattgctgaacctgtgattggtgctggtggtgttatccttcctccaaagacatat
tttgagaagattcaagcagtggttaagaagtatgacatcctttttattgtagatgaggtt
attactggatttggaaggttgggaaccatgttcggatctgatttgtataacatcaaacca
gatcttgtctccttggccaaggctctttcttctgcctatgctcccattggagcgatactt
gttagcccggaaatatcagatgtgattcattctcatagtaacaagctcggtacatttgct
catggctttacatattctggccatcctgtttcctgtgctgttgctttagaggcgctgaaa
atttatcgggaaagagatattcctggtcatgtcacacatgttgctcaaaggttccaggag
ggaatcaaggcctttgcagctggaagtccaattgttggggagacacgtggtgtaggattg
ctgatagcaactgagttcaccgataacaaatcaccatatgagttattcccttttgagtgg
ggtgttggtgaaatatttggacaggagtgtaagaaacgtggcatgatggttaaggttctt
ggaaacttgatagcgatgtccccaccactgataataacccgtgaagaaattgataaactg
gtgagcatatatggagaagctctgaaggcaacagaggaaagagtggcagagctaaaatcc
aagaagaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336982
Entry
4336982           CDS       T01015                                 
Name
(RefSeq) probable gamma-aminobutyrate transaminase 2, mitochondrial isoform X3
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4336982
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4336982
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     4336982
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4336982
NCBI-ProteinID: XP_015635718
UniProt: Q7XN12
LinkDB
Position
4:31166107..31174732
AA seq 497 aa
MNLIKHAAFAASFQGETDCTSHASARKFSTSGSSPLLDSTEGNGFKGHSMLAPFTAGWHS
TDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSF
WNSTAKPPLDLAEELISMFTAKEMGKVFFTNSGSEANDSQVKLVWYYNNALGRPNKKKII
AQSQAYHGSTLISASLSGLPAMHLKFDLPAPFVLHTDCPHYWRFGLPGEAEEEFATRLAD
NLENLILKEGPETVAAFIAEPVIGAGGVIPPPKTYFEKIQAVLQKYDVLFIADEVITGFG
RLGTMFGSDLYNIKPDLVSLAKALSSAYVPIGATLVSPEISDVVHSQSNKIGFFAHGFTY
SGHPVSCAVALEALKIYRERNIPAHVKQISPRFQEGIKAFAGSSIIGETRGVGLLLATEF
ANNKSPNDPFPVEWGVAQIFGAECKKRGMLVKVVGDEIAMSPPLIMSQREVDGLVSIYGE
ALKATEERVAELRSKKK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaatttgataaagcatgcagcttttgctgcaagttttcaaggggaaacggattgtacc
tcacatgcatcagctaggaagttcagcacctcaggatcttcccctctgctagactcaacc
gaaggaaatgggtttaagggacactccatgctggcaccattcactgccggatggcactcc
acagacctggagcccttgattattgaaagatcagagggttcttatgtctatgatagcaag
gggaacaagtacttggatacactagcaggattgtggtgtacagccttaggtggcagtgag
cctcggttagtgaaagcagcaaccgaccaattaaacaagttgccgttctaccactccttt
tggaacagtacagccaagccaccattggatcttgctgaggaacttatcagcatgttcact
gccaaggaaatgggaaaagtgttctttacaaacagcggttctgaagcaaatgactctcag
gtcaaactagtatggtactataacaatgcattggggagaccaaacaagaaaaagatcatt
gcacaatcacaagcatatcacggatcaacattaatatcagctagtctgtctggcctccct
gcgatgcatctgaagtttgatctaccagcaccttttgttctgcacacagactgccctcac
tactggcgcttcggtcttcctggtgaggcagaagaagaatttgcaaccagacttgccgat
aatttagagaatcttatcctcaaagaagggccagaaacagttgctgctttcattgctgaa
cctgtaattggtgctggaggtgtcatccctcctccaaagacatattttgagaagattcaa
gcagtacttcagaagtacgatgtccttttcatagcagatgaggtaattactggatttgga
cggctgggaaccatgtttggatctgatctgtacaacatcaagccagatctcgtctcctta
gcaaaggcactctcatctgcgtatgtcccaattggagcgactcttgtcagcccagaaata
tccgatgtagttcattctcagagcaataagattggcttttttgctcatggctttacatac
tctggccatccagtttcttgtgctgtcgccctagaagctctgaaaatttatcgggaaagg
aacatccctgctcatgtcaagcaaatttctccaaggttccaggagggaatcaaggccttc
gcgggaagttcaattataggagagacacgtggtgtaggtttgctgctcgcgactgaattt
gctaataacaaatcaccaaatgatccatttcctgttgagtggggagttgcgcaaatcttt
ggagcagagtgtaagaagcgtggtatgctagttaaggttgttggagatgagatcgccatg
tcgccaccactaataatgagccaaagagaagttgatggactggtgagcatatacggtgaa
gctttgaaggccaccgaggaaagagtggcagagctgaggtccaagaaaaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336983
Entry
4336983           CDS       T01015                                 
Name
(RefSeq) gamma-aminobutyrate transaminase 1, mitochondrial
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4336983
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4336983
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     4336983
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4336983
NCBI-ProteinID: XP_015636709
UniProt: Q7XN11
LinkDB
Position
4:31176650..31182433
AA seq 516 aa
MVIARGLLRSNASSSSSQAINLLKYVTSTGSLQGHTQNLCDASTRHFSSVPSPQYNSTEE
NGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYLDSLAGLWCTALGGSEPR
LVKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMGKVFFTNSGSEANDSQVK
LVWYYNNALGRPDKKKFIARSKSYHGSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYW
RFHLPGETEEEFATRLANNLEELILKEGPETIAAFIAEPVMGAGGVIPPPKTYFEKVQAI
VKKYDILFIADEVITAFGRLGTMFGSDMYNIKPDLVSMAKALSSAYVPIGAIMVSPEISD
VIHSQSNKLGSFAHGFTYSGHPVACAVAIEALKIYQERNIPDHVKQISPRFQEGVKAFAG
SPIVGEIRGVGLILGTEFADNKSPNDPFPAEWGVGAIFGAECQKRGMLVRVAGDNIMMSP
PLIMTPDEVEELVSIYGDALKATEERVAELKSKKNN
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggtgattgcgcgcggccttctccgatcgaatgcctcttcttcctcctctcaggcaatc
aacttattgaagtatgtaactagcactggaagtctgcaagggcacacgcaaaatttgtgt
gatgcatcaaccagacatttcagttcagtaccatcgccccagtacaactcaactgaagag
aatgggttcaaggggcatggcatgttggcaccattcacagctggttggcagagcaccgat
gttcatccgttagtcattgaaagatctgagggttcgtatgtatatgatatcgacggaaag
aagtatctagattctcttgcgggactatggtgtacagctttaggtggtagtgaacctcga
ttagtcaaagctgcaactgagcaattacacaagttgcccttctatcactccttttggaac
cgtacgaccaaaccatctctggatcttgcaaaggaactgcttagcatgttcactgcaagg
gaaatgggaaaagtgttcttcacaaatagtggttcagaagcaaatgattctcaggtaaaa
ctggtctggtattataacaatgcactgggaaggccagacaagaagaaatttattgcacga
tcaaaatcataccatggatcaacactaatatcagctagtctatccggtcttcctgcactg
catcagaagtttgatctgcctgcaccttttgttctgcacacggactgccctcactactgg
cgcttccatcttcctggtgaaacagaagaagaatttgcaactagacttgccaataattta
gaggaacttatcctcaaagaaggaccagaaacaattgctgcattcattgcagagcctgtg
atgggtgctggtggtgtcatacctcctccaaagacctattttgaaaaggtccaagcgatc
gttaagaagtatgacatccttttcatagcagatgaggtcattactgcatttggaaggttg
ggaaccatgtttggaagtgatatgtataacatcaagccagatctagtctccatggccaag
gcgctttcatctgcctatgtgcccattggagcaattatggttagcccagaaatatcagat
gttattcattctcagagcaataagctcggttcatttgctcatggatttacatactctggc
catccagttgcatgtgctgtcgccatagaagccctgaaaatttatcaggaaaggaacatt
cctgatcatgtgaagcaaatttctccaaggttccaggagggagtcaaggcctttgcagga
agtccgattgttggagagatacgtggtgtagggttgatacttggaactgaattcgcagac
aacaaatcgccaaatgatccattccctgctgaatggggcgtcggcgcgatctttggagcg
gagtgccagaagcgcggcatgctggttagagttgctggagacaacatcatgatgtcacca
ccattgataatgacccctgatgaagtcgaggagctggtgagcatctatggagatgcactc
aaggccaccgaggagagggtggctgagctgaaatccaagaagaacaattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344928
Entry
4344928           CDS       T01015                                 
Name
(RefSeq) probable gamma-aminobutyrate transaminase 3, mitochondrial
  KO
K16871  4-aminobutyrate---pyruvate transaminase [EC:2.6.1.96]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00650  Butanoate metabolism
osa01100  Metabolic pathways
Module
osa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    4344928
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4344928
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.96  4-aminobutyrate---pyruvate transaminase
     4344928
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 4344928
NCBI-ProteinID: XP_015648304
UniProt: Q6ZCF0
LinkDB
Position
8:complement(6170104..6175788)
AA seq 510 aa
MICRSLLLLRSNAASKASNIVKHVAATGCLPKYSSEAPARYFSSEPSLQVDSTEENGFKG
HGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIKAA
TDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIFFTNSGSEANDSQVKLVWYY
NNALGRPNKKKFIARSKSYHGSTLVSASLSGLPALHQKFDLPAPFVLHTDCPHYWRFHLP
DETEEEFATRLATNLENLILKEGPETIAAFIAEPVMGAGGVIPPPKTYFEKIQAVLKKYD
ILLIADEVITAFGRLGTMFGCDMYDIKPDLVSIAKALSSAYMPIGAILVSPEITDVIYSQ
SNKLGSFAHGFTYSGHPVSCAVAIEALKIYKERNIIEHVQKIAPRFQEGIKAFSGSPIVG
EIRGLGLILGTEFVDNKSPNDPFPAEWGVGSLFGAECEKRGMLIRVAGDNIMLSPPLIMT
PDEVEEIICKYGDALKATEERIAELKAKRG
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgatttgccgcagtctcctccttctcagatctaatgcggcctccaaggcaagcaacata
gtaaaacatgtagctgccactggatgtttgccaaaatattcctcagaggcaccagccaga
tatttcagctctgaaccgtctcttcaggtcgactcgacagaagaaaatgggttcaagggg
catggcatgctggccccattcactgctggatggcagagcaccgatttgcatcctctggtt
attgacagatctgagggttcttacgtttatgatatcaatgggaagaagtacatagatgct
cttgcaggattgtggtctacggcattgggtggtaatgagcctcgattgatcaaagctgca
actgatcaattgaacaaattacccttctaccactccttttggaaccgtactaccaaaccc
tcattggatcttgctaatgaaattctcagcatgttcactgcaagggaaatgggaaaaata
ttctttacaaatagtggttcagaagcaaatgattctcaggtaaagctagtttggtattat
aacaatgcattgggaagacctaacaagaagaaatttatcgcacgctcaaaatcatatcat
ggatcaacattagtgtcagccagtctatcaggtcttcctgctcttcaccaaaagtttgat
ctgccagctccttttgttctgcacacagattgccctcactactggcgcttccatcttcct
gatgagacagaagaagaatttgcaactagacttgccaccaacctggagaatcttattctc
aaagaaggaccagaaacaattgctgctttcattgctgaacctgtgatgggtgctggcggt
gttatccctcctccaaagacatactttgagaagattcaagcagtcctcaagaagtatgac
atcttattaatagcagatgaggtcattacagcatttggtagattgggaaccatgtttgga
tgtgatatgtatgacattaaaccagatcttgtctcaatagccaaggctctatcttctgcc
tacatgccaattggagctattcttgttagtccggaaataacagatgtaatttattcacag
agcaacaagctcggttcttttgctcatggatttacatactcggggcatccagtttcctgt
gctgtcgccatagaagcattgaagatttataaagaaaggaatatcatcgaacatgttcag
aaaattgccccaaggttccaggagggaatcaaggccttctctggaagtccaattgtaggc
gagatacgtggtttaggactgatacttgggactgaatttgtcgacaacaagtctccgaat
gatccattccctgctgaatggggtgttggttcattgtttggtgccgagtgtgagaagcgc
ggaatgcttatcagggttgctggggataacattatgctttcgccaccgcttataatgact
cctgatgaagttgaagaaattatttgcaaatatggtgatgccctgaaggccacagaggaa
aggattgcagagctcaaagccaagaggggttag

DBGET integrated database retrieval system