KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328107
Entry
4328107           CDS       T01015                                 
Name
(RefSeq) choline/ethanolaminephosphotransferase 1
  KO
K00993  ethanolaminephosphotransferase [EC:2.7.8.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4328107
   00565 Ether lipid metabolism
    4328107
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4328107
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.1  ethanolaminephosphotransferase
     4328107
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 4328107
NCBI-ProteinID: XP_015625220
UniProt: A0A8J8Y9N5 Q0E4H0
LinkDB
Position
2:1040497..1045766
AA seq 389 aa
MGYVGQHGVATLRRYKYSGVDHSLVAKYILQPFWSRFVNLFPLWFPPNMITLTGFMFLLT
SAFLGFFYSPHLDTAPPRWVHLAHGMLLFLYQTFDAVDGKQARRTNSSSPLGELFDHGCD
ALACAFEALAFGSTAMCGKATFWYWFIAAVPFYCATWEHFFTNTLILPIVNGPTEGLMLI
YLCHFFTFFTGAEWWAQDFRKSIPLLNWVPLVPEVPVYGIALFLMIAFAVIPTIGSNIHN
VYKVVEARKGSMLLALAMLFPFGLLLAGVLVWSYLSPSDIMRNQPHLLVIGTGFAFGFLV
GRMILAHLCDEPKGLKTGMCMSLAYFPFAIANALTARLDDGNPLVDEQLVLLMYCLFTVA
LYMHFATSVIHEITNALGIHCFRITRKKA
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggggtacgtggggcagcacggggtggcgacgctgcggaggtacaagtacagcggcgtc
gaccactcgctcgtcgccaagtacatcctccagcccttctggtcacgattcgtcaacctc
ttcccgctctggttcccgccaaatatgattacactgacaggcttcatgtttctattgaca
tcggcattccttggctttttttattcccctcatctcgatacagcaccacctagatgggtg
caccttgcacatggaatgcttctcttcctttaccagacttttgatgctgtggatggtaaa
caagcaagacgtaccaactcatcaagtcctttaggcgagctatttgaccacggatgtgat
gcgcttgcatgtgcttttgaggccttggcttttggaagcacggcaatgtgtggaaaagct
accttctggtattggttcattgctgctgtcccattttactgcgcaacctgggaacacttt
ttcacaaacacactaattcttcctatagtcaacggaccgactgaaggccttatgctaatc
tatttgtgccattttttcaccttcttcacaggagctgaatggtgggcacaagatttccgg
aagtcaatacccctactaaactgggtacctcttgttcctgaggtcccagtatatggaatt
gcactgtttctaatgatagcttttgctgtaattccgacgattggatctaacattcacaat
gtgtacaaagtggtcgaggcaagaaaaggaagcatgctgctggcactagcaatgctcttt
ccttttggtttgctgttggccggagttcttgtctggtcctacctatctccttcagatata
atgagaaaccagccacatcttctagttattggaactggttttgcatttggctttcttgtg
ggcagaatgattctggctcacttatgtgatgagcccaaaggtctgaagacagggatgtgc
atgtccctagcatatttcccatttgcaattgcaaatgcgctgactgcacggcttgatgat
ggaaacccccttgttgatgagcagctagttctcctaatgtactgcttatttaccgtggct
ctctacatgcattttgctacatctgttatccatgaaatcaccaatgctctcgggattcat
tgcttcaggatcactaggaaaaaggcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340428
Entry
4340428           CDS       T01015                                 
Name
(RefSeq) choline/ethanolaminephosphotransferase 1
  KO
K00993  ethanolaminephosphotransferase [EC:2.7.8.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa00565  Ether lipid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4340428
   00565 Ether lipid metabolism
    4340428
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4340428
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.1  ethanolaminephosphotransferase
     4340428
SSDB
Motif
Pfam: CDP-OH_P_transf RseC_MucC
Other DBs
NCBI-GeneID: 4340428
NCBI-ProteinID: XP_015643854
LinkDB
Position
6:complement(5276589..5286150)
AA seq 391 aa
MGYIGAHGVETLKRYRYSGQDHSVVAKYVLQPFWSRCVTLFPLWMPPNMITLTGFMFLVV
SALLGYIYSPHLDTAPPRWVHLAHGLLLFLYQTFDAVDGKQARRTSSSSPLGELFDHGCD
ALACAFEALALGSTLMCGRFTFCFWVIAAVPFYLATWEHFFTNTLILPLINGPTEGLMLI
YLSHSFTFLTGAEWWAQDFRKSIPLLSWVPLPFIPDIPLYIIVMILMILFAVIPTIGSNV
SNVQKVVEARKGSMVLALAMLLPFIALLTGVAVWSYLSPSDIMRNQPHLLVIGTGFAFGY
LVGRMILAHLCDEPKGLKTGMCMSLVFLPFAIANALTAKINAGIPLVDELLVLFLYCAYT
VGLYLHLAVSVVHEIKDALGIYCFRITRKEA
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggggtacatcggggcgcacggggtggagacgctgaagcggtacaggtacagcgggcag
gaccactcggtggtggccaagtacgtgctccagcccttctggagcagatgcgtcaccctc
ttcccgctctggatgccacctaatatgatcacactcactggattcatgtttctagttgta
tcagcacttcttggctatatctattcgccccacctcgacacagctccccctaggtgggtc
catcttgcccatggattacttctcttcttataccagacttttgatgctgttgatggtaaa
caagcaaggcgcactagctcatcaagtcctctaggagaactttttgatcatggatgtgat
gctcttgcctgtgcttttgaagcattagcccttggaagcaccttgatgtgtggaaggttt
actttctgtttctgggtgattgctgctgtcccgttctatcttgcaacatgggaacacttc
tttacaaatacacttattcttcctttaataaatggacctacggagggcctgatgctgata
tatctatcccactcttttacctttcttactggcgctgaatggtgggcacaagattttcgg
aagtcgataccccttttaagttgggtaccccttccatttattccagatatccccttatac
attattgtgatgattcttatgatcctgtttgccgtaatccctaccattggatccaatgtc
agcaatgtccaaaaagtagttgaagcaagaaaaggaagcatggtattggcattggcaatg
ctccttcctttcattgcattgttaactggagttgctgtctggtcttacctctctccttca
gatattatgaggaatcagccacatctgcttgtgatcggaactggttttgcttttggatat
ttggtgggaaggatgatacttgctcatttatgtgatgaacccaaaggtctcaaaactgga
atgtgcatgtctctggtgtttcttcctttcgctattgcaaatgctctcacagcaaagatc
aatgctgggattcctttagttgatgagctgctggttcttttcctgtattgcgcatacaca
gtgggcctttacctgcatcttgccgtttctgttgtgcatgaaatcaaggatgctcttgga
atctattgcttcaggataactagaaaagaggcttga

DBGET integrated database retrieval system