KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328147
Entry
4328147           CDS       T01015                                 
Name
(RefSeq) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00660  C5-Branched dibasic acid metabolism
osa00966  Glucosinolate biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    4328147
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4328147
  09110 Biosynthesis of other secondary metabolites
   00966 Glucosinolate biosynthesis
    4328147
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     4328147
    4.2.1.35  (R)-2-methylmalate dehydratase
     4328147
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-GeneID: 4328147
NCBI-ProteinID: XP_015625698
UniProt: Q6Z702 B9F279
LinkDB
Position
2:complement(1304864..1309849)
AA seq 514 aa
MASISAASPVAGKAAAFAHKNELAAAAVAPSQQQLQRRVSGRRARSGRVRAVATPARAPR
APSSTGSVKSAMTMTEKILARASERASLEPGENVWVDVDVLMTHDVCGPGTIGIFKREFG
EDAKVWDREKVVIIPDHYIFTSDERANRNVDILRDFCMEQNIKYFYDIKDLSNFKANPDY
KGVCHVALAQEGHCRPGEVLLGTDSHTCNAGAFGQFATGIGNTDAGFVMGTGKALLKVPP
TIRFVLDGEMPPYLLAKDLILQIIGEISVSGATYKSMEFVGSTVESLNMEERMTLCNMVI
EAGGKNGVVPADQTTFNYLEGKTSVEYEPVYSDAQARFVSDYRFDVSKLEPVIAKPHSPD
NRALARECKDVKIDRVYIGSCTGGKTEDFFAAAKVFLASGKKVKVPTFLVPATQKVWMDI
YSIPVPGAGGKTCSQIFEEAGCDTPASPSCGACLGGPRDTYARMNEPMVCVSTTNRNFPG
RMGHKEGQIYLASPFTAAASALTGYVTDPRDFLM
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggcctccatctccgccgcctcccccgtcgctgggaaggccgccgccttcgcccacaag
aacgagctcgccgccgccgccgtggcgccgtcgcagcagcagctgcagcggagggtgagt
gggaggagggcgcgttcggggagggtccgcgccgtcgccacgcccgcccgcgccccccgc
gccccgtcctccactggctcggtgaagagcgccatgacgatgacagagaagatcctggcg
agggcgtcggagcgcgccagcttggagcccggggagaacgtgtgggtggacgtcgacgtg
ctgatgacgcacgacgtctgcggccctggcaccatcgggatcttcaagcgggagttcggg
gaggacgccaaggtttgggaccgagagaaggtggtcatcatcccggaccactacatcttc
accagcgatgagcgagcaaaccgaaatgttgatatcctcagggatttctgtatggagcag
aacatcaagtacttctatgacatcaaggacctgagcaatttcaaagcaaatccagactac
aagggtgtttgccacgttgctcttgctcaagagggtcattgcagaccaggcgaggttctc
cttggtactgattctcatacatgcaatgctggagcctttggccaatttgcaactggaatt
ggaaacactgatgctggttttgtgatgggcactgggaaggctcttcttaaggtgcctcca
actatcaggtttgtattagatggagaaatgccaccttatttacttgcaaaggatctgatt
ttacaaattattggtgagatttctgtatctggcgcaacatacaaatccatggagtttgtt
ggatcaactgtggaaagtctaaatatggaagagcgaatgacactgtgcaacatggttatt
gaagctggtggcaagaatggtgttgtgcctgccgatcaaactacatttaactatcttgag
ggcaagacatcagttgaatacgagcctgtctatagtgatgctcaggccagatttgttagt
gactaccggtttgatgtatccaaattggagccagttattgccaagccacattcacctgac
aaccgtgctctagcaagagagtgcaaagatgtcaagattgaccgggtctatatcggttct
tgtactggaggtaaaactgaggacttctttgctgctgcgaaggtgttcttagcttcgggg
aagaaggttaaagttcccacttttctcgttccggcgacacaaaaggtgtggatggacatt
tatagcatccctgtaccaggagccggtggcaaaacttgctcacagatatttgaggaggct
ggttgtgatacaccagctagccctagttgtggtgcttgtttgggtggtcctcgtgataca
tatgctcgcatgaatgaacctatggtgtgtgtgtcgacgacgaacaggaatttccccggc
aggatggggcacaaggaagggcagatctacctggcttcgccgttcaccgcggcggcttca
gccctcaccggatacgtcactgaccccagggacttcctgatgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330192
Entry
4330192           CDS       T01015                                 
Name
(RefSeq) 3-isopropylmalate dehydratase small subunit 3
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00290  Valine, leucine and isoleucine biosynthesis
osa00660  C5-Branched dibasic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    4330192
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    4330192
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     4330192
    4.2.1.35  (R)-2-methylmalate dehydratase
     4330192
SSDB
Motif
Pfam: Aconitase_C Hydrolase_like
Other DBs
NCBI-GeneID: 4330192
NCBI-ProteinID: XP_015627253
UniProt: A3A9R2 Q6H6I1
LinkDB
Position
2:complement(26465708..26469287)
AA seq 257 aa
MAAAAAAPALSLAEAAPVTAVLAPCPTPSRTFRRRSWVAAICRPALKCHHSRPLTAVVAA
AAAAAAAGDSTSAGVFHGECFVVGDNIDTDQIIPAEHLTLVPSKPDEYRKLGSFAFVGLP
TAAYPTPFVAPGEETTRYAVIIGGANFGCGSSREHAPVALGAAGARAVVAEGYARIFFRN
SVATGEVYPLELADTGAWKECKTGDVVTVELDNCVMINHTSGKQYKLKPIGDAGPVIEAG
GIFAYARKTGMIASKSA
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctccggctctatccttggccgaggcggcgccggtgacagca
gttctggcaccgtgtcccacgccctcgaggacgttccgccgccgcagctgggtcgcggct
atctgccggcccgccctgaaatgccaccacagtcgtcccctgaccgccgtggtcgccgcg
gctgcggctgccgctgcggcgggggactcgacgtcggccggcgtattccacggcgagtgc
ttcgtcgtgggggataacatcgacaccgaccagatcatcccggccgagcacctgaccctg
gtcccgtccaagcccgacgagtaccgcaagctcggctcgttcgccttcgtcggcctcccc
accgcggcctacccgacgccgttcgtcgcccccggcgaggagaccacccgctacgccgtc
atcatcggcggcgccaacttcggctgcggctcctcccgcgagcacgcgcccgtcgccctg
ggcgccgccggcgcccgcgccgtcgtggccgagggctacgcgcgcatcttcttccgcaac
tccgtggccaccggtgaggtctacccgttggagctagcggacactggagcctggaaggag
tgcaagaccggggatgtggtcacggtggaacttgataattgcgtcatgatcaaccacaca
tccggcaagcagtacaagctgaagcctatcggcgatgccgggccggttattgaggcaggc
gggatctttgcctatgcccggaagaccggaatgatcgcatccaagtctgcgtga

DBGET integrated database retrieval system