KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328159
Entry
4328159           CDS       T01015                                 
Name
(RefSeq) Golgi SNAP receptor complex member 1-2
  KO
K08495  golgi SNAP receptor complex member 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4328159
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328159
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    4328159
SSDB
Motif
Pfam: V-SNARE_C Laminin_II Miga LOH1CR12 BAR_3
Other DBs
NCBI-GeneID: 4328159
NCBI-ProteinID: XP_015627527
UniProt: Q6Z2M4 Q0E4B9
LinkDB
Position
2:1402564..1404538
AA seq 247 aa
MMPSASDAAAAAAALELQESGWEELRREARKLEGDLDVKLSSYARLAARSSSAADAASAS
SPSERSSWKSMEFEIQSLLDKLQDVNDAMSRCAASTAPTTSVSQKLARHRDILHEFAQEF
RRTRGNLSSIREHADLLSSVRDDITESKATGGMSPRVHLLRERASIHGSINQIDEVIGQA
QSTRVALSNQRALFGDVQGKVKQLGEKFPVIRGLLGAIKRKKSKDTIILSAVIAACTIFL
IIYWLSK
NT seq 744 nt   +upstreamnt  +downstreamnt
atgatgccgtcggcgtcggacgccgcggcggcggcggcggcgctggagctgcaggagtcc
gggtgggaggagctgcggcgggaggcacggaagctggagggtgacctcgacgtcaagctc
tcctcctacgcgcgcctcgccgcgcgctcctcctccgccgccgacgccgcctccgcctcc
tccccgagcgagcgctcctcctggaagtccatggagttcgagatccagtcgctgctcgac
aagctgcaggacgtcaacgacgccatgagccgctgcgccgcctccaccgcccccaccacc
tccgtctcgcagaagctcgcccgccaccgcgacatcctccacgagttcgcgcaggagttc
aggaggacgagggggaatctgagctccatcagggagcacgccgatctcctcagctctgtg
cgggacgacattactgagtccaaggctactggcggcatgtcgccgagggtgcatttgctc
agggagagggcctcgattcatggcagcattaaccagattgatgaggtaattggccaagct
cagagcacaagggtagccctttccaatcagagggcattgtttggggatgttcaaggaaaa
gtcaagcagttgggtgaaaagttccctgttattagaggactacttggtgccatcaagagg
aagaaatcaaaggacactatcatcctttcagcagtgatcgcggcctgcaccatctttttg
attatttactggctttcgaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345680
Entry
4345680           CDS       T01015                                 
Name
(RefSeq) Golgi SNAP receptor complex member 1-1
  KO
K08495  golgi SNAP receptor complex member 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4345680
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4345680
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    4345680
SSDB
Motif
Pfam: V-SNARE_C Not3 4HB_MCP_1 Sec20 COG5 Apolipoprotein Bap31_Bap29_C IMD
Other DBs
NCBI-GeneID: 4345680
NCBI-ProteinID: XP_015650150
UniProt: Q0J5F1 Q6Z9I2
LinkDB
Position
8:complement(21400078..21403497)
AA seq 217 aa
MEASSWDALRKQARRLEAQLDDQMSAYRKLISMKSDGSENDIESDIERSLKQLQQVNSQM
QTWVSSGGSEVLSHTLTRHMEILQDLTQEFYRLRSSLRAKQQHASLLDLRDFDRAKFDVE
EGADSDQALLKEQAAISRSTGQMDTVISQAQATLGTLMLQRSTFGGITTKISNVSSRLPT
INQILSSIKRKKSMDTIILSLVASVCAFLIFIYWMSK
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggcgtcttcctgggacgccctccgcaagcaggcaaggaggctagaagctcagtta
gatgaccaaatgagtgcttaccgtaaattgatttccatgaaatctgatggttctgagaat
gatatcgagtccgatatagaaagatcgctgaagcaacttcagcaagtaaattctcaaatg
cagacatgggtatcatcaggaggctcagaagtcctttctcatacattgactcgtcatatg
gagatattgcaagaccttacacaggaattctatcgcctccgatcaagccttagagcaaag
caacaacatgcttctcttcttgacttgagagattttgacagagcgaagtttgatgttgaa
gagggtgctgactctgatcaagctctgctcaaagaacaagctgcgatcagcaggagtact
gggcagatggataccgtgatatcacaagctcaagctacattaggcacacttatgttgcaa
cgatcaacatttggtggtattactacgaagataagcaacgttagcagtcggctccctacg
attaatcaaattctttcatccatcaaaagaaagaaatcgatggacaccattattctatcc
ctggttgcatctgtttgtgcatttcttatttttatctattggatgtcaaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347065
Entry
4347065           CDS       T01015                                 
Name
(RefSeq) Golgi SNAP receptor complex member 1-1
  KO
K08495  golgi SNAP receptor complex member 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    4347065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4347065
Membrane trafficking [BR:osa04131]
 SNARE
  SNAP-25[N] (Qb)
   Gos1 (Gos28)
    4347065
SSDB
Motif
Pfam: V-SNARE_C Not3 Sec20 COG5 4HB_MCP_1
Other DBs
NCBI-GeneID: 4347065
NCBI-ProteinID: XP_015611820
UniProt: Q6EQ07 B9G3K9
LinkDB
Position
9:complement(14921690..14926332)
AA seq 217 aa
MEASSWDALRKQARRLEAQLDDQMIAYRKLVSMKSDGSENDIESDIERSLKQLQQVNSQM
QTWVSSGGSEVLSHTLTRHMEILQDLTQEFYRLRSSLRVKQQHASLLDLRDFDRAKFDVE
SGDSADQALLREQAAISRSSGQMDNVISHAQATLGTLMSQRSTFGGITTKISNVSSRLPT
INHILASIRRKKSMDTIILSLVASVCAFLILVYWLSK
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggcgtcttcttgggacgcccttcgcaagcaggcaaggaggttggaagctcagtta
gatgatcaaatgattgcataccgtaaattggtgtctatgaaatcagatggttcagagaat
gatatcgagtctgatatagaaagatcactgaagcagcttcagcaagtaaattctcaaatg
caaacttgggtatcatcaggaggctctgaagttctttctcacacattgacccgtcatatg
gagattttgcaagatcttactcaggaattctatcggcttcgatcaagcctcagagtgaag
caacaacatgcttcgctccttgacctaagagattttgacagagcaaagtttgatgttgag
agtggagactcagccgatcaagctcttcttagagaacaagctgcaatcagtaggagttct
ggacagatggataatgtgatatcacatgctcaagcaacgctaggaactctcatgtcacaa
cgatcaacatttggtggcatcactacaaagataagcaatgttagtagccggcttcctacg
atcaatcatatcctcgcgtcaattagaagaaagaagtcgatggacacaatcattctttca
cttgtcgcgtctgtctgcgcctttcttattctcgtctactggttgtcaaagtag

DBGET integrated database retrieval system