KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328183
Entry
4328183           CDS       T01015                                 
Name
(RefSeq) beta-amylase 8
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4328183
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4328183
SSDB
Motif
Pfam: Glyco_hydro_14 BES1_N TcdB_toxin_midN
Other DBs
NCBI-GeneID: 4328183
NCBI-ProteinID: XP_015622759
LinkDB
Position
2:1539391..1547343
AA seq 667 aa
MSLKHPHSPVLDGDPPPHRRPRGLVSTPPPPAVAADTSPSPSPSPAAPPPRRRGGGGGGG
EREREREKERTKLRERHRRAITSRMLSGLRQHGNFPLPARADMNDVLAALARAAGWTVHP
DGTTFRASSQPLHPPTPQSPGIFHVNSVETPSFTSVLNSYAIGTPLDSQASMLQTDDSLS
PSSLDSVVVADQSIKNEKYGNSDSVSSLNCLENHQLTRASAALAGDYTRTPYIPVYASLP
MGIINSHCQLIDPEGIRAELMHLKSLNVDGVIVDCWWGIVEAWIPHKYEWSGYRDLFGII
KEFKLKVQAVLSFHGSGETGSGGVSLPKWVMEIAQENQDVFFTDREGRRNMECLSWGIDK
ERVLRGRTGIEAYFDFMRSFHMEFRNLTEEGLISAIEIGLGVSGELKYPSCPERMGWRYP
GIGEFQCYDRYMQKNLRQAALSRGHLFWARGPDNAGYYNSRPHETGFFCDGGDYDSYYGR
FFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIYWWYRTASHAAELTAGFYNPTNR
DGYSPVFRMLKKHSVILKFVCYGPEFTIQENNEAFADPEGLTWQVMNAAWDHGLSISVES
ALPCLDGEMYSQILDTAKPRHDPDRHHVSFFAYRQLPSFLLQRDVCFSELGNFVKCMHGE
ATQIVEG
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgagcctgaagcacccgcactctccggtgctggacggggacccgccgccgcaccgccgc
ccgcggggcctcgtctccaccccacccccacccgccgtcgcggccgacacctccccctcc
ccctccccctcccccgcggcgcctccgcctcggcggcgcggcggcggcggagggggaggc
gagagggagagggagagggagaaggagcggacgaagctgagggagcggcaccgccgggcc
atcaccagccgcatgctgtccgggctgcggcagcacggcaacttcccgctccccgcccgc
gccgacatgaacgacgtcctcgccgccctcgcgcgcgccgcagggtggaccgtgcatccc
gacggcaccaccttccgcgcctcgtcgcaacccctccaccctcccaccccccaatcgcca
gggatttttcatgttaattctgttgaaaccccatcttttactagtgttctcaacagctac
gccatcgggacaccattagactcgcaggcttctatgctacaaacagatgatagtttatcg
ccatcatcgttggactctgttgtggtggcagaccaaagcataaaaaatgagaaatatggg
aattcagattctgtcagctctctgaattgtttggaaaatcaccagctgacgagagcatca
gcagcgctggcaggtgattacaccagaactccatatataccagtctatgcttctctgcct
atgggcattatcaatagccattgccaattgattgatccagagggcatacgtgcagaactg
atgcatctgaagtctttgaatgttgatggagttatcgttgactgttggtgggggatagtg
gaagcctggattcctcacaaatacgagtggtctggttacagggaccttttcggtatcatt
aaagagttcaagctaaaagttcaggctgtattgtcattccatgggtctggggagactgga
tctggtggtgtgtctctcccaaagtgggtcatggaaattgcacaagagaaccaggatgta
ttttttactgatcgtgaaggtaggagaaatatggaatgtctttcctggggaattgacaaa
gagcgagtccttcgcgggagaactggcatcgaggcgtattttgatttcatgaggagcttt
catatggaattcagaaacctgaccgaagagggccttatttctgctatcgaaattggattg
ggtgtttctggagagctaaaatacccttcatgtccagaaagaatgggctggagatatcct
ggtattggtgagtttcagtgttacgacaggtatatgcaaaagaaccttagacaagcagca
ttgtcacggggacatctgttttgggcccgtggacctgataatgcgggctattataattca
agacctcatgaaactggctttttttgtgacggaggtgactatgacagctactatggacgc
tttttccttaactggtattctggaatcctcatagatcatgtggaccaggtgctatcactt
gctactcttgcatttgatggagtcgaaactgttgtgaagattccatctatctattggtgg
tatagaactgcaagccatgctgcggaacttacggcaggattctacaaccctacaaataga
gatggatactctccagtgttcagaatgctcaagaagcattccgtaattctaaagtttgtt
tgttatggaccagaatttacaattcaagagaataatgaagcatttgctgatccagaaggt
ttaacatggcaggttatgaatgcagcatgggatcatggattatctataagtgtagagagt
gctcttccatgtcttgatggtgagatgtactcacagatccttgacacagcgaagcctagg
catgatcctgaccgtcaccatgtctcgttctttgcataccgtcagctaccctcattcctt
ttgcagagagacgtttgcttctcagagcttggcaactttgtcaagtgtatgcacggggag
gctacccagattgtggaaggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331577
Entry
4331577           CDS       T01015                                 
Name
(RefSeq) beta-amylase 1, chloroplastic
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4331577
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4331577
SSDB
Motif
Pfam: Glyco_hydro_14 DUF1887
Other DBs
NCBI-GeneID: 4331577
NCBI-ProteinID: XP_015632708
UniProt: Q10RZ1
LinkDB
Position
3:2272950..2276401
AA seq 557 aa
MMSLNLAHQTGAAAAVAPAAPRTAVVAAAAGTVSAPAVAPAAAPSLQLQTQTVDPAAPAQ
GPDLPMAFQALVESLPEEQHPDVGGEERRKVGVPVYVMMPLDTVRKDGNGLNRRKAVEAS
LKALKSAGAEGIMVDVWWGIAECEGPGRYNFTGYMELMEMAKKNGLKVQAVMSFHQCGGN
VGDSVTIPLPKWVLEEMDKDQDLAYTDRSGRRNYEYLSLGADAMPVLKGRTPVQCYGDFM
RAFRDHFAAFMGNTIVEIQVGMGPAGELRYPSYPESNGTWRFPGIGEFQCYDRYMLSSLK
AAAEAVGKPEWGNAGPGDSGGYNDWPEDSPFFRREGGWNTPYGEFFMSWYSQMLLEHGER
ILSAASGVYTGTPGVKISVKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYQPIARMLARH
GAVLNFTCVEMRNHEQPQDAQCRPEELVQQVAAAARESGVGLAGENALPRYDETAHDQIV
TTAAEKAEEERMVAFTYLRMGPDLFQPDNWRRFAAFVKRMTESGVRDVCREQVEREAQGV
AHATGSLVHEAAVALSN
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgatgtcgctcaacctggctcaccagaccggagcggcggccgccgtggcaccggcggcg
ccacgtacggccgtggtcgcggcggctgcgggtacagtgtctgctccggcggtcgcgccg
gcggcggcgccgagcctgcagctgcagacgcagactgtggacccggcggcgccggcgcag
gggccggacctccccatggccttccaggcgctggtcgagagcctgccggaggagcagcac
ccggacgtgggcggcgaggagcggcgcaaggtgggcgtgccggtgtacgtgatgatgccg
ctggacacggtgcgcaaggacggcaacgggctgaaccggcggaaggcggtggaggcgtcc
ctgaaggcgctgaagagcgccggcgccgaggggatcatggtggacgtgtggtggggcatc
gccgagtgcgagggccccggccgctacaacttcaccgggtacatggagctcatggagatg
gccaagaagaacgggctcaaggtgcaggccgtcatgtcgttccaccagtgtggcggcaac
gtcggcgactcagtcactataccacttccgaaatgggtgttggaggagatggacaaggac
caggacctggcctacacggatcggagcggccgccgcaactacgaatacctctcgctcggc
gccgacgccatgccggtgctcaagggccgcacgccggtgcagtgctacggcgacttcatg
cgcgccttccgcgaccacttcgccgccttcatgggcaacaccatagtcgagattcaagtc
ggcatgggtccggccggtgagctccgctacccgtcgtacccggagagcaatggcacctgg
agattccccggcatcggcgagttccagtgctatgacaggtacatgctgagcagtctcaag
gcggcggcggaggcggtgggcaagccggagtggggcaacgccgggccgggagactccggc
gggtacaacgactggccggaggactcgcccttcttccgccgtgaaggtgggtggaacact
ccctacggtgagtttttcatgagctggtactcgcagatgctcctggaacacggcgagcgc
atcctgtcggcggcgtcgggcgtgtacaccggcacacccggcgtgaagatctccgtgaag
gtggccggcatccactggcactacggcacgcggtcccacgccgcggagctgacggcaggg
tactacaacacgaggcaccacgacgggtaccagccgatcgcgcgcatgctggcccgccac
ggcgcggtgctcaacttcacgtgcgtggagatgcgcaaccacgagcagccgcaggacgcg
cagtgccggcccgaggagctggtgcagcaggtggcggccgcggcgcgggagtccggcgtg
gggctcgccggcgagaacgcgctgccgaggtacgacgagacggcgcacgaccagatcgtg
acgacggcggcggagaaggcggaggaggagcgcatggtagcgttcacctacctgcgcatg
gggcccgacctgttccagccggacaactggcgccgcttcgccgcgttcgtgaagcgcatg
acggagtccggcgtgcgggacgtgtgccgcgagcaggtggagcgggaggcgcagggcgtc
gcgcacgccaccgggtcgctcgtgcacgaggccgccgtcgcgctcagcaactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343510
Entry
4343510           CDS       T01015                                 
Name
(RefSeq) beta-amylase isoform X1
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4343510
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4343510
SSDB
Motif
Pfam: Glyco_hydro_14 DUF2610
Other DBs
NCBI-GeneID: 4343510
NCBI-ProteinID: XP_015645184
LinkDB
Position
7:21470805..21473504
AA seq 631 aa
MPRIHRTKPRTSSKNFQIWTNIARTASLLPIMITTSSPSSQPVRLQQRWTCRSRAASPAP
LLPPPATGRRRRRRLVADSQKTAASLRVRAIAAESEQASPLPEPPPLLTEEEEEEEKMLA
NYVPVYVMLPLGVVTAENELEDAAGLRARLRRLRREAGVDGVMADVWWGIVEGAGPARYE
WRAYRELFRVAQEEGLKVQAIMSFHACGGNVGDAVTIPLPRWVRDVGDDDPDVYYTSPGG
ARNHEYLTIGVDVRPLFHGRTAIQLYADFMKSFRENMGDFLDSGLIVDIEVGLGPAGELR
YPSYPESQGWEFPGIGQFQCYDKYLEEDFRAAATEAGHPEWELPGDAAGEYNYTPEDTRF
FAADGGTYLTEAGRFFLTWYSSKLLEHGDRVLDEANMAFLGCSLKLAAKVSGIHWWYRHP
SHAAELAAGYYNVPGRDGYRPVARMLARHDGAVLNFTCAEMRDSEQPPEAMSSPERLVRQ
ALSAAWREGVEAACENALSRHDRRGYNQMLLNARPNGVGPAGGGGAPPRRVAAVTYLRLS
DELLTATNFRAFKAFVRKMHADQDCCPDPARYGRPMRPLERSGPEVAIERLLDATAPEPP
YPFDGETDMSVGGGLAELIDWVFDKVEWIFC
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgccgagaattcaccggacaaagccaagaacatctagcaaaaattttcaaatttggaca
aacatagcccggacagcttcgctgctgcccatcatgattacaacctcgtcgccatcgtcg
cagccggtcaggctgcagcaacgatggacatgccggagcagagcggcgtctcctgctcct
cttcttccaccgccggcaaccgggcggcggcgtcggcggcggctcgtcgccgactcccag
aagacggcggcttctctccgggtccgtgctattgccgctgagagcgaacaggcttctcct
ctacccgagcctccgccattgctcaccgaggaggaggaggaggaggagaagatgctcgcc
aactacgtccccgtctacgtcatgctcccgctgggcgtggtcaccgcggagaacgagctg
gaggacgcggcggggcttcgggcgcggctgcggcggctgcggcgggaggccggcgtggac
ggcgtcatggcggacgtgtggtggggcatcgtcgagggcgccgggccggcgcggtacgag
tggcgcgcgtacagggagctgttccgcgtggcgcaggaggaaggactcaaggtgcaggcc
atcatgtcgttccacgcctgcggcggcaacgtcggcgacgccgtcaccatcccgctgccg
cgctgggtccgcgacgtcggcgacgacgaccccgacgtgtactacacgagccccggcggc
gcgaggaaccatgagtacctcaccatcggcgtggacgtccggcctctgttccacggcagg
actgccatccagttgtatgccgatttcatgaagagcttcagagagaacatgggtgacttc
ttggactctggcctgatcgtggacatagaggttggcctcggccctgcaggtgagcttaga
tacccatcctacccagagagccaaggttgggaattccccggcatcggacagttccagtgt
tatgacaaatacctggaggaggacttcagagcggcggcgacagaggccgggcacccggag
tgggagctgccgggcgacgccgccggagagtacaactacacgccggaggacacgcggttc
ttcgcggcggacggcggcacgtacctgaccgaggccgggaggttcttcctgacgtggtac
tccagcaagctgctcgagcacggcgacagggtcctcgacgaggcgaacatggcgttcctg
ggctgcagcctcaagctcgccgcgaaggtgtccgggatccactggtggtaccggcacccg
agccacgccgcggagctcgccgcggggtactacaacgtgcccggccgcgacgggtaccgc
cccgtcgcgcgcatgctggcgcggcacgacggcgccgtgctcaacttcacctgcgccgag
atgcgggactcggagcagccgccggaggcgatgagctcaccggagcggctggtgcggcag
gcgctgagcgcggcgtggagggagggcgtcgaggcggcgtgcgagaacgcgctgagcagg
cacgaccggcgcgggtacaaccagatgctgctgaacgcgcggcccaacggcgtcggcccc
gccggcggcggcggcgcgccgccgcgccgcgtcgccgccgtgacgtacctccggctgtcg
gacgagctcctgacggcgaccaacttccgggccttcaaggccttcgtcaggaaaatgcac
gccgatcaggattgctgtccggatccggcccggtacgggaggcccatgaggcctctggag
aggtctgggccggaggtggccatcgagcggctgctggacgcgacggcgccggagccgccg
tatccgttcgacggcgagacggacatgagcgtcggcggcggcctcgccgagttgatcgac
tgggtgttcgacaaggtcgagtggatattctgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347903
Entry
4347903           CDS       T01015                                 
Name
(RefSeq) beta-amylase 2, chloroplastic isoform X1
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4347903
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4347903
SSDB
Motif
Pfam: Glyco_hydro_14
Other DBs
NCBI-GeneID: 4347903
NCBI-ProteinID: XP_015611670
UniProt: A0A0N7KRA8 Q652P5
LinkDB
Position
9:22711764..22716617
AA seq 533 aa
MISSPALFFLLQPGRPSIAAPPLPSSPAPPLRGISISPVAARPISSLRSSSSIRIISPPH
ALPDPLLSLPSMDPQEVPDLLPPRPPERDFAGTPYVPVYVMLPLGVVNGNGEVVDADVLV
GQLRVLKAAGVDGVMVDCWWGNVEAHRPQEYNWTGYKRLFHMIRELKLKLQVVMSFHECG
GNVGDDVSIPLPHWVTEIGRSNPDIYFTDRAGRRNTECLSWGIDKERVLQGRTGVEVYFD
YMRSFRVEFDEYFEDGIISEIEIGLGACGELRYPSYPAKHGWKYPGIGEFQCYDRYLQKS
LRRAAEARGHTIWARAPDSAGHYNSEPNLTGFFSDGGDYDSYYGRFFLNWYSQVLVDHAD
RVLMLARLAFEGSDIAVKVSGVHWWYKTASHAAELTAGFYNPCNRDGYASIAAVLKKHGA
ALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRDGFNKI
LENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEAVLDLQV
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgatttcttctcctgcgctcttcttcctcctccagccaggccgcccctccatcgccgcg
ccgccgctcccctcctcgccggcgcctcccctccgcggcatctccatctcccccgtcgcc
gcccgccccatctcctccctccgctcctcctcctccatcaggatcatctcgccgccgcac
gccctccccgacccgctcctctccctcccgtccatggacccccaagaggtgcccgatctg
ctgcccccgcgcccaccggagcgcgacttcgccggaacgccatacgtccccgtctatgtc
atgctcccgcttggagtggtcaatggtaatggcgaggtggtcgacgccgacgtcttggtg
ggccagcttcgggtactcaaggctgccggcgtcgatggggtcatggtcgattgctggtgg
gggaatgtcgaggcccacaggccgcaggagtacaattggaccggttacaagcgactcttc
catatgatcagggagctcaagctcaagctgcaggtggtcatgtcattccatgagtgtgga
ggcaatgttggagatgatgtgtctattcctctcccacattgggtaacagagatcggaaga
agcaatccagatatctacttcaccgacagggctggcaggcgtaacacggagtgcctttca
tggggcattgataaagaaagggttcttcaaggacggacaggggtcgaggtatactttgac
tacatgagaagcttccgagtagaatttgatgaatattttgaggatggtatcatttcagaa
attgagattgggctaggggcttgtggagagttgaggtatccatcttatccagcaaaacat
gggtggaaataccctggcattggagaatttcagtgctacgacagatacttacagaaaagt
ttaagaagagctgcagaagcacgaggacataccatatgggcaagagcgccagacagtgca
ggccattataattctgagccaaatctgactggatttttctctgacggaggagattatgat
agctactatggtcgttttttcctcaattggtattcccaggtgttggtggatcatgctgac
cgtgtattgatgttagccaggttggcttttgaaggttcagatattgctgttaaggtttca
ggtgtacactggtggtacaaaactgccagtcatgctgctgaattgactgctgggttttat
aacccatgcaaccgtgatggttatgcctcaattgctgctgtcctgaaaaaacatggtgca
gctttgaactttacatgtgttgaactgcgcactatggatcagcatgaggtatttcctgag
gcctttgcagatccagagggccttgtatggcaggtgctaaatgctgcatgggatgctggc
ataccagtagctagtgagaatgctctgccttgctacgatagagatggctttaacaaaatt
ttggagaatgcaaagccactgaatgatccagatgggaggcatttactaggattcacgtac
ctgaggctcaccaaagtcctcttcgagagagctaattttttggaatttgagcgtttcgtt
aagagaatgcatggtgaagcagttctcgatctacaggtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348840
Entry
4348840           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4348840
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4348840
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4348840
SSDB
Motif
Pfam: Glyco_hydro_14 PfkB
Other DBs
NCBI-GeneID: 4348840
NCBI-ProteinID: XP_015613699
LinkDB
Position
10:17180760..17183455
AA seq 1005 aa
MALNLAQSAAAAACFATAGDARRAASVVAMPSSSSSATTSLRMKRQAACEPVACRAVARH
VAAAAASSRRNGVPVFVMMPLDTVSKCGSALNRRKAVAASLAALKSAGVEGIMVDVWWGI
VESEGPGRYNFDGYVELMEMARKTGLKVQAVMSFHQCGGNVGDSVNIPLPRWVVEEMEKD
NDLAYTDQWGRRNFEYISLGCDAMPVFKGRTPVECYTDFMRAFRDHFASFLGDTIVEIQV
GMGPAGELRYPSYPESNGTWRFPGIGAFQCNDRYMRSSLKAAAEARGKPEWGHGGPTDAG
GYNNWPEDTVFFRGDCGGWSTEYGEFFLSWYSQMLLEHGERVLSGATSVFGDGAGAKISV
KVAGIHWHYGTRSHAPELTAGYYNTRHRDGYLPIARMLARHGAVLNFTCVEMRDHEQPQE
AQCMPEALVRQVAAAARAAGVGLAGENALPRYDGTAHDQVVAAAADRAAEDRMVAFTYLR
MGPDLFHPDNWRRFVAFVRRMSESGSPREAAESAAHGVAQATGSLVHEAAVALRSYLQCC
TLNHEAGLRTLRLPLRADDLTTSLGICLELVVLDLPQAELLSAPGWLHMLHTDMDPLPDN
ASLALTMPLLLRCSPAASPPLLPRRRSGSLLSAAPPGRRPLLPAAAGRVVLGCGLVTLDY
LATVDAYPRPDDKIRSGELQVSGGGNAGNALTGAARLGLNTRLISKVANDEIGGTVLSEL
KEAGIDISHVIISDGGNTTFVYVIIDKQTKTRTCIITSGYPPMIPSDLRMSSLSAALQDV
SLLYLDGYSDEMALAVAKQADQMKIPILVDAEPERTREELGGLLSLASYIVCNGKFPEKW
TSVPSIPSALLEILLQYPRACFAVVTLGENGCMMLERGKDGENYETEPVDIENVAESLRL
KVDKDDILPTCVSSKFMRLTARGSGNIFARLLIGTAESIPASELVDTTGCGDAFIGAVLH
GLSTEMPPEKMLPFACQVAGIKCRAIGARSGLPWQSDPRLTKYLC
NT seq 3018 nt   +upstreamnt  +downstreamnt
atggccttgaacttggctcagagcgccgcggcggcagcgtgcttcgcgaccgccggtgat
gcgcggcgagctgcttcggtggtcgccatgccgtcgtcgtcgtcgtcggccacgacgagc
ctgaggatgaagaggcaggcggcgtgcgagccggtggcgtgccgggcggtggccaggcac
gtggcggcggcggcggcgagcagcaggaggaacggcgtgccggtgttcgtgatgatgccg
ctggacacggtgagcaagtgcgggagcgcgctgaaccggaggaaggcggtggcggcgagc
ctggcggcgctgaagagcgccggcgtggaggggatcatggtggacgtgtggtggggcatc
gtggagagcgagggccccggccggtacaacttcgacggctacgtggagctcatggagatg
gcccgcaagaccggcctcaaggtccaggccgtcatgtccttccaccagtgcggcggcaac
gtcggcgactccgtcaacatcccgctcccgaggtgggtggtggaggagatggagaaggac
aacgacctcgcctacaccgaccaatggggacgccgcaacttcgagtacatctccctcggc
tgcgacgccatgcccgtcttcaagggccgcacgcccgtcgagtgctacaccgacttcatg
cgcgccttccgcgaccacttcgcctccttcctcggcgacaccatcgtcgaaatccaagtc
ggcatgggccccgccggcgagcttcggtacccgtcctacccggagagcaacggcacctgg
aggttccccggcatcggcgccttccaatgcaacgacaggtacatgcgtagcagcctgaag
gcggcggcggaggcgaggggcaagccggagtggggccacggcgggccgacggacgccggc
ggctacaacaactggccggaagacacggtgttcttccgcggcgactgcggcgggtggagc
accgagtacggcgagttcttcctgtcgtggtattcgcagatgctgctggagcacggcgag
cgcgtgctgtcgggcgcgacgtccgtgttcggcgacggcgccggcgccaagatctcggtc
aaggtggccggcatccactggcactacggcacgcggtcgcacgcgccggagctcacggcg
gggtactacaacacgcggcaccgcgacggctacctcccgatcgcgcgcatgctggcgcgc
cacggcgccgtgctcaacttcacctgcgtggagatgcgcgaccacgagcagccgcaggag
gcgcagtgcatgcccgaggcgctcgtcaggcaggtggccgccgcggcgcgcgcggcgggc
gtcgggctcgccggggagaacgcgctgccgcggtacgacggcacggcgcacgaccaggtg
gtcgccgccgccgccgaccgcgcggcggaggaccggatggtcgccttcacctacctccgg
atggggcccgacctcttccacccggacaactggcgccggttcgtcgccttcgtccgccgc
atgtccgagtctggctcgccgcgggaggccgccgagagcgccgcgcacggcgtcgcgcag
gccaccggctcgctcgtgcacgaggccgcggtcgcgctccggagctatctccagtgttgc
accctcaaccatgaagccgggcttaggaccctgcggctgcctcttcgtgctgatgacctc
accacgagccttggcatctgccttgagctggtcgttcttgatcttcctcaggcggaactc
ctcagtgcacctggatggctgcacatgctccacacggacatggatcctcttcctgataat
gcgtcactcgctctcaccatgccgctcctcctccgctgctcgccggcggcgtcaccgcct
ctgctcccgcgccgccgcagcggctccctcctctccgctgcgccgccggggcgccggccg
ctgctccccgccgccgcaggccgcgtcgtgctgggttgcgggctggtgacgctggactac
ctcgccacggtggacgcgtacccgcggcccgacgacaagatccgcagcggcgagctgcag
gtgtctggaggtggcaacgccgggaacgcgctgacaggagccgcccgcctgggcctcaac
acgaggctcatctccaaggtggcaaacgatgaaattggaggaaccgttctttcggagctt
aaggaagctgggattgatatatctcatgttataatttctgatggtggaaacacaacattt
gtatatgtcattattgataagcaaacaaaaactcgtacgtgtataatcacatcagggtac
cctccaatgatacctagtgacttgagaatgtcaagtttgtcagctgcactgcaagacgta
agcttactatacttagatggatattcagatgagatggccttggcagttgctaagcaggct
gatcagatgaagattcctattttggttgatgccgaaccagaaagaacaagggaagaattg
ggaggtttgctcagcctagcaagttacatagtctgtaatgggaaatttccagagaaatgg
acatcagtcccatctattccctctgcactactagaaatccttctgcaatatcctcgtgca
tgcttcgcagttgtaacccttggagaaaatggatgcatgatgcttgagaggggcaaagat
ggtgaaaattatgaaactgagccagtagatatagagaatgtcgctgagtccttaaggctg
aaagtagataaagatgatatcctgccaacttgtgtatcatctaagttcatgagacttact
gcaagagggtctgggaatatatttgcaaggctgctcataggaacagcagaaagtattcca
gcttcagagcttgttgatacaactggttgtggtgatgcattcataggagcagtacttcat
ggactatccacagagatgcctccagaaaagatgctgccttttgcttgccaagtggcaggc
atcaaatgtagagcaatcggcgcacgatctggcctaccatggcaatccgatccacgcctg
actaagtacctgtgttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349417
Entry
4349417           CDS       T01015                                 
Name
(RefSeq) beta-amylase 3, chloroplastic
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    4349417
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     4349417
SSDB
Motif
Pfam: Glyco_hydro_14
Other DBs
NCBI-GeneID: 4349417
NCBI-ProteinID: XP_015614593
UniProt: Q9AY35 A0A5S6RC15
LinkDB
Position
10:complement(22324199..22327680)
AA seq 544 aa
MALTLRSSTSFLSPLDPSSKREDAPPCCVVPMPAPGSGGRLRLARAAPVEHATMEEMASP
EAATLLHHGGGGGQGQRRGKGTAVYVMLPLETVGAGGKVARARALAASLAALRSGGVEGV
MVDVWWGVVEREGPRRYDWEGYGELVRMVERAGLRLQMVMSFHQCGGNVGDSCNIPLPGW
VLEEMKSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYSDYMRSFRDTFCGYLG
NTIVEIQVGLGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLQQAAAAAGHEEWG
RGGPHDAGEYKQFPEETGFFRRDGTWCTEYGDFFLGWYSGMLLEHGDRVLAAAEAVFRGT
GAALSAKVAGIHWHYRTRSHAAELTAGYYNTRRRDGYAPVAAMLARRGAVLNFTCMEMRD
EQQPEHAGCSPEQLVRQVRSAARAARVGLAGENALERYDEAAFAQVVATAASAGLGAFTY
LRMNKKLFDGDNWRQFVSFVRAMADGGERAALPSCDTEQSDLYVGFLEKRAAPEAEAAAA
AAVV
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggcgttgacgctgcgttcatccacgtcgttcctgtcgccgctcgacccgtcctccaag
cgcgaggacgcgccgccgtgctgcgtcgtccccatgccggcgccggggagcggcggcagg
ctgcggctcgccagggcggcgccggtggagcacgcgacgatggaggagatggcgtcaccg
gaggcggcgacgctgctgcaccacgggggcgggggcgggcaggggcagcggcgggggaag
gggacggcggtgtacgtgatgctgccgctggagacggtgggggcgggggggaaggtggcg
cgggcgcgggcgctggcggcgagcctggcggcgctgcggagcggcggggtggagggggtg
atggtggacgtgtggtggggggtggtggagcgggaggggccccggcggtacgactgggag
ggctacggcgagctcgtccgcatggtggagcgcgccggcctccgcctccagatggtcatg
tccttccaccagtgcggcggcaacgtcggcgactcctgcaatatcccgttgccgggatgg
gtgttggaggagatgaagtcgaacccggacatcgtgtacacggacaggtcgggtcgtcgg
aatccggagtacatctcgctcggctgcgacacgctgccggtgctcaagggcaggacgccc
atccaggtctactccgactacatgcgcagcttccgcgacacattctgcggctacctcggc
aacaccatcgtggagatccaagtaggattggggccttgtggtgagctgaggtatccttcg
tatcctgaggccaatggaacatggcgtttccctggcatcggcgagttccaatgctatgac
aagtacatgagggcgtcgctgcagcaggcggcggcggcggcggggcacgaggagtggggg
aggggcgggccgcacgacgccggcgagtacaagcagttcccggaggagacggggttcttc
cggcgagacggcacgtggtgcaccgagtacggcgacttcttcctcgggtggtactccggg
atgctgctggagcacggcgaccgcgtcctggccgccgccgaggccgtcttccgcggcacc
ggcgccgcgctctcggccaaggtcgccggcatccactggcactaccggacgcggtcgcac
gccgcggagctcacggcggggtactacaacacgcggcgccgcgacgggtacgcgcccgtc
gcggcgatgctggcgcggcgcggcgcggtgctcaacttcacgtgcatggagatgcgggac
gagcagcagccggagcacgccgggtgctcgccggagcagctggtgcggcaggtgcggtcc
gcggcgcgcgcggcgcgcgtggggctcgccggcgagaacgcgctggagcggtacgacgag
gcggcgttcgcgcaggtggtggccaccgcggcgagcgccgggctgggcgcgttcacgtac
ctgcgcatgaacaagaagctgttcgacggcgacaactggcgccagttcgtgtcgttcgtc
agggccatggccgacggcggcgagcgggcggcgctgcccagctgcgacaccgagcagtcg
gacctctacgtcgggttcctcgagaagagggcggcgccggaggccgaggcggccgccgcc
gccgccgtcgtgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267841
Entry
9267841           CDS       T01015                                 
Name
(RefSeq) beta-amylase
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    9267841
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     9267841
SSDB
Motif
Pfam: Glyco_hydro_14 YceG Glyco_hydro_35
Other DBs
NCBI-GeneID: 9267841
NCBI-ProteinID: XP_015644700
UniProt: Q6Z5B2
LinkDB
Position
7:21503743..21506374
AA seq 488 aa
MAGNLLANYVQVNVMLPLDVVTVDNKFEKVDETRAQLKKLTEAGVDGVMVDVWWGLVEGK
GPGSYDWEAYKQLFRLVQEAGLKLQAIMSFHQCGGNVGDIVNIPIPQWVRDVGASDPDIF
YTNRGGARNIEYLTLGVDDQPLFHGRTAIQMYADYMKSFRENMAEFLDTGVIVDIEVGLG
PAGEMRYPSYPQSQGWVFPGIGEFICYDKYLEADFKAEAAKAGHPEWELPDDAGEYNDTP
EKTRFFADNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWW
YRVPNHAAELTAGYYNLDNRDGYRTIARMLTRHRACVNFTCAEMRDSEQSSEAKSAPEEL
VQQVLSAGWREGLHVACENALGRYDATAYNTILRNSRPTGINKNGPPEHKLFGFTYLRLS
DELLEGQNYSTFKTFVKRMHANLDYNSNVDPLEPLQRSMPEMPIGKILQAAHPKLAPFPF
DENTDLPV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggccgggaacttgctagccaactatgttcaagtcaatgtcatgctccccctggatgtg
gtgactgtggacaacaagttcgagaaggtcgatgagacccgggcacagctgaagaagctg
acggaggccggcgtcgatggcgtcatggtggacgtgtggtgggggctggtggaggggaag
ggccccgggtcctacgactgggaggcctacaagcagctgttcaggctggtgcaggaggcc
gggctgaagctgcaggccatcatgtcgttccaccagtgcggtggtaacgtcggcgacatc
gtcaacatcccgatcccgcagtgggtgcgggatgtcggcgcgagcgaccccgacatcttc
tacaccaaccgtggtggggcgaggaacatcgagtacctcacccttggagtggatgaccag
cctctcttccatggaagaactgccatccagatgtatgctgactacatgaagagcttcagg
gagaacatggcagagttcttggatactggtgtcattgtggacattgaggtggggcttggt
ccagctggtgagatgagatacccttcctacccccagagccagggatgggtgttcccaggc
ataggagaattcatatgctatgataaatacctggaggcagatttcaaagcagaagcagca
aaggctgggcatcctgaatgggaattgcccgacgatgctggagagtacaatgacactccc
gagaagacccggttcttcgcggataatggaacatatgtcactgagaaggggaagttcttc
ctcacatggtactcaaacaagctgataaaacatggagacaagatcttggatgaagcaaac
aaggtcttcttgggatgcagagtgcagctggcaatcaaaatctccggcattcattggtgg
tatagggttccaaaccatgcagctgagctcactgctggatactacaacttggacaacaga
gatggctacagaaccatcgcacgcatgctcacaaggcaccgtgcctgcgttaacttcaca
tgtgctgagatgagggattctgaacaaagctcagaggcaaagagtgcaccagaagaacta
gtccaacaggtcctgagtgctggatggagagagggcttacatgtggcatgcgaaaacgca
ctcggtcgatacgatgcaacagcttacaacacaatactaaggaattcaaggccgacaggc
atcaacaagaatggacctcctgagcacaagctatttggattcacctacctccgattatca
gacgagctgctggagggacagaactacagcacattcaaaactttcgtcaagaggatgcat
gctaacctggattataattcaaatgttgacccattggagcctttgcaaagatcaatgcca
gaaatgccaattggaaagatcttacaagcagcacacccaaaattggcgccatttcccttt
gatgagaataccgacctgccggtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268236
Entry
9268236           CDS       T01015                                 
Name
(RefSeq) beta-amylase 3, chloroplastic
  KO
K01177  beta-amylase [EC:3.2.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00500  Starch and sucrose metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    9268236
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     9268236
SSDB
Motif
Pfam: Glyco_hydro_14
Other DBs
NCBI-GeneID: 9268236
NCBI-ProteinID: XP_015613032
UniProt: Q5NB81
LinkDB
Position
1:complement(7577704..7582950)
AA seq 566 aa
MAAIAAPPPQPHPPASAHHHHHHRRRARLPRLAAASSSSSSSRFRRRFSSSSSSSSPSSA
PSPSPSSSSSSSSSSSYGGSGGGGGGEIHYASPPPPPPAAPTGAPVYVTLPADAVGPGGG
VARRRAMAASLAALAGAGVAGVAVELWWGVVERQGPGVYDWAGYLELAAMARRYGLRVRA
ILAFHQCGAGPHDPPWIPLPQWVLEEMDKLPDLSYMDRYQRRNKEYISLGCDILPILKGR
SPMQAYSDFMRSFRDAFKEYLGAIVTEVQIGMGPGGELRYPSCPTETLSQAGISSELGEF
QCYDKFMQASLSARAQLIGMQDWGNGGPAGTDGSRQNPEETSFFRADGGCWNTPYGRFFL
EWYSGMLLLHGERLCMVADAVFSGSGVTIAGKVSGIHWHYYTCSHPSELTAGYYNTLLRN
GYLPITQMFARYKAALCCSCFDLRDEERNNSKSSPEGTLRQLMVAAKMCNLPLNGENSVT
RLDDTSLNQVIRSSRLYSGGTSGTSFSFNYVRMNKSLFEFHNWNRFTKFVRQMSDARTFL
ARLEFRRGQHYLSSMSVVWVVSRACA
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggcggcgatcgccgcgcctccgccgcagcctcacccacccgcgtccgcccaccaccac
caccaccatcgccgccgcgcccgtctcccccgcctcgccgccgcctcctcctcctcctcc
tcttcccgcttccgccgccgcttctcctcttcctcctcatcctcatccccttcgtccgcg
ccctcaccctccccctcctcctcctcctcctcctcctcctcctcctcctatgggggaagc
ggagggggaggcgggggagagatccactacgcgtcgccgccgccgccgcccccggcggcg
ccgacgggggcgcccgtgtacgtgacgctcccggcggacgccgtggggccggggggcggg
gtggcgcggcggcgcgccatggcggcgtcgctcgcggcgctggcgggggcaggggtggcc
ggggtggcggtcgagctgtggtggggggtcgtggagcggcaggggcccggggtgtacgac
tgggcggggtacctcgagctcgccgccatggcgcgccgctacggcctccgcgtgcgcgcc
atcctcgccttccaccagtgcggcgccggcccgcacgaccctccatggatccctctacct
caatgggtacttgaggagatggataagttgccagacttgtcatatatggatagataccaa
cgaagaaataaagaatacatctcactcgggtgtgatattcttccgattctgaagggaaga
tcaccaatgcaggcttattcagacttcatgaggagctttcgagatgcttttaaagagtac
cttggggctatagtgacagaagttcaaattggaatgggcccaggaggtgaacttaggtat
ccatcatgcccaactgagacactaagtcaagcaggcatctcatctgaactcggggagttt
caatgttatgacaagttcatgcaagcatccctgagtgctcgtgcacaacttattggcatg
caagattggggaaacggtggtccagccggcacagatggctcacgacagaaccctgaagaa
actagttttttccgtgctgatggtggatgctggaatactccttatggtcggtttttcctt
gagtggtattcaggaatgctgcttcttcatggagagagattatgtatggttgctgatgct
gtcttctctggttccggtgtgaccatcgccggaaaggtttctggaatacattggcactac
tatacatgttcgcacccatcggaactgactgctggttactacaacacattgttgaggaac
ggttatcttcctatcacccaaatgtttgctagatacaaggctgccttgtgctgcagttgc
tttgacctgagggatgaggagagaaataactccaagagcagcccagaaggtactctccgg
caacttatggtcgccgccaagatgtgcaatctacctctgaacggcgaaaactccgtgaca
aggctcgacgatacgtcgctgaatcaagtcatcagaagctcaaggctctactcaggtggc
acctcagggacatctttctccttcaactatgtcagaatgaacaagagcctgtttgagttt
cacaactggaacaggttcaccaagttcgtcaggcagatgtcggatgccaggacatttcta
gccaggctcgagttcaggagagggcagcattacctctcctcgatgtcggttgtctgggtc
gtcagccgggcctgtgcatag

DBGET integrated database retrieval system