KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328220
Entry
4328220           CDS       T01015                                 
Name
(RefSeq) L-aspartate oxidase, chloroplastic
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00250  Alanine, aspartate and glutamate metabolism
osa00760  Nicotinate and nicotinamide metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00115  NAD biosynthesis, aspartate => quinolinate => NAD
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4328220
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    4328220
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     4328220
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Pyr_redox_3
Other DBs
NCBI-GeneID: 4328220
NCBI-ProteinID: XP_015622817
UniProt: Q6Z836
LinkDB
Position
2:1821736..1826418
AA seq 645 aa
MAALMNGFGSLQCKATVHVEKGHMQASGMAFFSPVNRCAQVHISSIPHFIGAKSVSASQL
RMRHKVGSIRASAASCLQDETTKYFDFVVIGSGVAGLRYALEVSKYGSVAIITKAEPHES
NTNYAQGGVSAVLCPSDSVESHMQDTIVAGAYLCDEETVRVVCTEGPERVKELIAMGASF
DHGEDGRLHLAREGGHSHNRIVHSADMTGREIERALLQAVDNDDNISLFGHHFAIDLLTC
QSNGEIYCYGVDSLDAETQKAIRFISKVTLLASGGVGHIYPSTTNPPVATGDGIAMSHRA
QAVISNMEFVQFHPTALSDEGLPIKPATRRENAFLITEAVRGDGGILYNQSMERFMTSYD
DRAELAPRDVVARSIDDQLKKRGEKYVLLDISHKPREKVLAHFPNIAAECLRHGLDITQQ
PIPVVPAAHYMCGGVRAGLQGETNVKGLYVAGEVACTGLHGANRLASNSLLEALVFARRA
VQPSIDHMVDADVDPSFAKKWARPVLSVSLRDSILSDIIEKTKQARMELQSIMWEYVGIV
RSTNRLKHAEWKISDLESEWEEFLFRRGWKPTMVGVETCEMRNLFCCAKLVVKSALARHE
SRGLHFTEDFPYLEESKRKPTVIFPTHIQELTWSSKPLQKQLQCK
NT seq 1938 nt   +upstreamnt  +downstreamnt
atggcggctctgatgaacggctttgggagcctccaatgcaaggcgacggtgcatgtcgag
aaagggcacatgcaagcatcggggatggccttcttctctcccgtcaacagatgcgcccag
gttcatatctccagtattcctcatttcatcggcgcgaagtctgttagtgcttcccaactt
cgaatgaggcacaaggtcgggtccatcagagcctctgcagcctcgtgcttgcaagatgaa
acaacaaaatatttcgattttgtggtcattggcagcggtgttgctggcctaaggtatgct
ctggaagtgtctaagtacggctctgtcgccatcattaccaaagcagagcctcatgagagc
aacacgaactacgcacaaggcggtgtcagcgcggttctatgcccctcagattctgtagag
agccacatgcaagacaccattgtcgcgggggcttatctgtgtgatgaagagactgtcagg
gtagtatgcacagaaggaccggagcgtgtgaaggagctcattgccatgggagcttcattt
gaccatggcgaggacggaaggctgcaccttgcaagggaaggtggacattctcacaacaga
atagttcattctgctgatatgactggaagagagatcgagagagcactgcttcaagcagtt
gataatgatgataacatatctttgtttggccaccactttgccattgatttactcacctgt
cagagtaatggtgaaatatattgctatggtgtggattcattggacgctgaaactcagaag
gcaattcgtttcatctcgaaagtaacattgcttgcatctggaggagttggtcatatatac
ccctcaacgaccaatccaccggtagctactggggatggaattgcaatgtctcatcgtgcg
caggctgtaatatctaatatggagtttgtgcagttccacccaactgcactatcagatgag
ggtctcccaataaaaccagctacaagaagagagaatgcattcctcataacagaagcagtc
agaggagatggaggaattctttataatcagtccatggagaggtttatgacttcgtatgat
gaccgtgcagagttagcaccgagagatgtggtcgcaagaagcatagatgaccaactgaag
aagaggggagaaaagtatgtcctcctggatatcagtcacaagccaagggaaaaggttctt
gcccattttccaaacattgcagctgaatgcctgcgccacggtctcgacatcacacaacag
ccgatacctgttgttcctgcagctcattacatgtgtgggggtgtccgggctgggttgcag
ggggagacaaatgtgaaaggcctgtatgttgctggtgaggttgcatgcactggattgcac
ggtgctaatcggcttgcaagcaactcactgcttgaagcactggtgtttgctcggagagca
gtgcagccttcaatagatcatatggtcgatgcagatgtcgatccttctttcgcgaagaaa
tgggctcgtcctgtgctgtctgtctcccttagggacagtatactatctgatatcattgag
aagacaaagcaggccaggatggagcttcagtcaataatgtgggagtatgtcgggatagtg
cggtcgacgaaccgcctgaagcacgcggaatggaagatcagtgatctggagtcagaatgg
gaggagttcttgttcaggagggggtggaagcctacaatggtgggggttgagacctgtgaa
atgaggaacctcttctgctgcgcaaagctggttgtgaaaagtgctcttgcaaggcacgag
agccgaggcttgcacttcaccgaagacttcccttacctggaggagagcaagaggaagcct
acagtgatcttccctactcatatccaggagctgacatggagctcaaagccattgcagaag
cagctgcagtgcaagtag

DBGET integrated database retrieval system