KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328285
Entry
4328285           CDS       T01015                                 
Name
(RefSeq) dolichol kinase EVAN isoform X1
  KO
K00902  dolichol kinase [EC:2.7.1.108]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00510  N-Glycan biosynthesis
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    4328285
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.108  dolichol kinase
     4328285
SSDB
Motif
Pfam: DUF3302 DUF423
Other DBs
NCBI-GeneID: 4328285
NCBI-ProteinID: XP_015625357
LinkDB
Position
2:2551590..2556277
AA seq 509 aa
MAMAMAPAVVSGERLVVFLFVARVALAAPAQLAAPLAVLAAAALAVELAVDGSASASSSP
LRRFRTRPGASSGILLGATTLPSVMLSRLIQLYRVLLADPNGREEYAYLEMQYWAVSVSC
LGMLSFFVWHLRQSPSNGNSIASKYGLLLIILYPLAYLFHLLLKTDGGLLVMSNLVYLLC
HGVAAVILIQHILEKFPSCSSFGEAILVSSGLVLYCGDMLAHTLSKMEFSVSSEAFIRAP
GTRSEIGTVIQGVLLGLFLLPLLYKSSLQVLAYCRKLESQRTQTVEECTQKRIDCGVFYV
SLLVALLLLVPSWTRLIQGFEVHPFVWVFNYIFTDSRERLALCAYWIFVIYVSIRRFYSI
SKQSKTERILLRKYYHLVAVLIFSPAVIFQPDFLDLAFGAAFAVFLILEMVRVWEIYPLG
HIVHQFMSAFTDHRDSEILIVSHFSLLLGCALPKWMSSGFNDRPLTPFAGILSLGIGDTM
ASMIGYKYGVLRWSKTGSEFNFHYYLFHD
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcgatggcgatggcgccggcggtggtctcgggcgagaggctcgtcgtgttcctcttc
gtcgcccgcgtcgcgctcgcggcgccggcccagctcgccgccccgctcgcggtcctcgcc
gcggccgccctcgccgtcgagctcgccgtggatggctccgcctccgcgtcctcatcgccg
ctccgccggttcaggaccaggccgggtgcttcatcaggcatacttcttggtgccactact
ctgcctagtgtcatgctttcacggttaattcaactttatagggtcttactagcagatcct
aatggacgtgaagaatatgcataccttgaaatgcagtactgggcagtatctgttagctgc
cttggcatgttatcattttttgtttggcatctacggcagtctcccagcaatggaaattct
atagcttcgaaatacggcttgttgctcatcattttatatcccctggcatacttgttccac
cttttactgaagactgatggaggtctgctggtgatgagtaatttggtgtatttgctgtgt
catggagtggctgctgtgatcttaatccagcatattctagagaagttcccttcatgttca
tcttttggggaggccattttggtctcaagtggtcttgttctttactgtggtgatatgctg
gctcatactctttcaaagatggagttctccgtatcatcagaagcatttattcgcgcacct
ggaactcgaagcgagataggcacagttattcagggggttttgcttggtctttttcttctc
cccttgttatacaaaagctcccttcaagttttggcttactgtagaaaactggagagtcaa
agaacacaaacagttgaggaatgcacacagaagagaattgactgtggtgtattttatgtt
tcattgttggtagcactattgttgttagtgccatcatggacgcgtcttattcaaggtttt
gaagtgcatccatttgtttgggtttttaactatattttcaccgattcacgtgaacggctt
gctttatgcgcatactggatatttgtgatatatgtatcaattagaaggttctacagtata
tcaaaacaaagcaaaacggagaggattcttttgcgcaagtattaccatctcgttgctgtc
ctaattttctctcctgcagtaatatttcagcctgatttcttggacttagcatttggtgca
gcatttgccgttttcttaatattggagatggttcgagtttgggaaatataccctcttggg
catattgtgcatcagttcatgagtgccttcactgatcatcgcgattcggaaattctaatt
gttagtcatttctcactcttgctgggatgtgcacttcctaaatggatgtcatcaggattc
aatgaccgacctcttacaccatttgctggaattctcagcttgggtattggtgataccatg
gcatcaatgataggttataagtatggtgtcctaagatggagcaagacaggaagtgagttt
aatttccattattatttattccatgattga

DBGET integrated database retrieval system