KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328287
Entry
4328287           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 2 homolog A
  KO
K03028  26S proteasome regulatory subunit N1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4328287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328287
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4328287
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2
Other DBs
NCBI-GeneID: 4328287
NCBI-ProteinID: XP_015626471
UniProt: Q6Z2Z3 A0A0P0VET4
LinkDB
Position
2:2563625..2571143
AA seq 898 aa
MAPPENPNGAGPAAPSDPAQPQPQPPAKSKWKKKDEKKDDDLSEEDLALKEQLELYVVRA
QDADPGVQKLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKSYFETMPESSDLKRYM
ADILSVLALTMSAEGERESLKYRLLGSEGDIGSWGHEYVRNLAGEIAQEFQKRQDDDMPI
DALMELVQQIVSFHMKHNAEPEAVDLLMEVEDLDLLVEHVDSTNYKRTCLYLTSSSKYLP
APDDMLALDIAYTIYMKFEDLTSALRIALLLDNKSMQYVKQVYTATEDLQLKKQFSFIIA
RHGLAMEIDDEIAADGNDKEGLQEIVNNSKLSEGYLTLARDIEVMEAKSPEDIYKVHLID
GRGASSSLDSARQNLAATFVNAFVNAGFGQDKLMTAPSDSSSSGASGNWLFKNKEHGKAS
AAASLGMILLWDTDSGLAQLDKYLHSNDAHVVAGALLGIGIVTCGVKNDCDPALAILMEY
INKDDTNIRIGAILGLGIAYAGSQKEELKSYLSTVLGDSEKSTLEVLIFSAIALGLVFVG
SCNEEIAQSIIFALMERSEAELAEPIIRLLPVALGLLYLGKQESVEATAEVSKTFDEKIR
KYCDVTLMSLAYAGTGNVLKVQKLLGICSQHLEKGETHQGPAVLGIALIAMAEELGAEMA
VRSLERLLQYGEQNIRRAVPLALGILCISNPKVNVMDTLSRLSHDADADVSMAAIISLGF
IGAGTNNARIAGMLRNLSSYYYKEAAHLFCVRIAQGLVHLGKGLLTLSPYHSDRFLLSPM
ALGGLVTVLHACLDMKSTILGKYHYILYIIVLAMQPRMLLTVDEDLKPLSVPVRVGQAVD
VVGQAGRPKTITGFQTHSTPVLLAAGERAELATEKYIPLTSVLEGFVILKKNPEYNEE
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggcgccgcccgagaaccccaacggcgcgggccccgcggcgccgtccgaccccgcgcag
ccgcagccgcagccgccggccaagtccaagtggaagaagaaggacgagaagaaggatgac
gatctgtcggaggaggatttggcgctcaaggagcagctcgagctctacgtggttcgggcg
caggacgcggatcccggcgtgcagaagctcgcgcttgagagtatgaggcaggagattcgt
tccgccacaagctcaatgacatctgtaccaaagccactgaaattcctccggccacactat
ggaacactcaagtcttactttgaaaccatgccagaatcttctgatttgaagaggtacatg
gccgacattttatcagtgttagctttgacaatgtccgctgaaggagaaagagaaagcctt
aagtaccgtttgttgggctctgaaggtgatatcggttcatggggtcatgaatacgtaaga
aatttggcaggcgaaattgcacaagaattccaaaagcgtcaggatgatgacatgccgatt
gacgctcttatggaactagtgcagcaaattgtttcattccatatgaagcataatgctgaa
cctgaagcagttgatcttctgatggaggtggaagatcttgatttgctagttgagcatgtt
gactctacgaactacaaaagaacttgcttgtaccttacaagttcatcgaaatacctccct
gctcctgatgacatgttggcgcttgacattgcttataccatttacatgaagtttgaagac
cttacaagtgctttgcggattgctctgctccttgacaacaagtcaatgcagtatgtgaag
caggtctacaccgcaactgaggatcttcagctcaaaaagcagttctcattcatcattgca
cgccatggtttggccatggagattgacgacgagatagctgccgatggcaatgataaggag
ggtttgcaagaaatcgttaataatagtaagctgagtgaggggtacctcacccttgctcga
gatatcgaagtgatggaagcaaaatctccagaggatatatataaggtccatttaattgat
gggcgtggtgccagctccagtcttgattctgcaagacaaaatttagctgcaacatttgta
aatgcattcgtaaatgctggatttggtcaggataagttgatgactgctccatctgattct
tccagtagcggagcttctggaaactggttattcaagaacaaggaacatgggaaagccagc
gcagcagctagcctgggaatgattctcttgtgggatactgattctggacttgctcagctt
gacaagtacttacatagtaatgatgctcatgttgttgctggagctttgctaggtattggt
attgtcacatgtggtgtgaagaatgattgtgatccagcacttgctattctcatggagtac
attaacaaggatgacacaaacattcggattggggcaatcttgggtcttggtattgcatat
gcgggttctcagaaagaggagcttaaatcttatctatcaactgtgttgggggactctgag
aaatcaactcttgaggtcctgatattctccgccatcgctctgggattggtgtttgttggt
tcttgcaatgaagagattgctcaatctatcatatttgccttgatggagcgcagtgaggct
gagctggcagaacccattatacgcctgcttcctgttgcgcttggtcttctgtatcttgga
aagcaggagagtgtagaggctacggcagaagtttctaaaacatttgatgagaagataaga
aagtactgtgatgtaacacttatgtcactagcatatgctggaacaggaaatgtgctcaag
gttcaaaagctccttgggatttgctcacagcatcttgagaaaggtgaaacccaccagggg
ccagctgtcctaggaattgcgcttattgcaatggctgaagaattaggagctgagatggct
gtacggtcacttgagcgtcttttacagtatggcgagcagaatattagacgggcagttcct
cttgctcttggcatactctgcatatctaatccgaaggtaaatgttatggacacgcttagc
agactgagtcatgatgcggatgctgatgtgtcaatggctgcaatcatttcattgggtttc
attggtgctggtacaaacaatgctagaatagctggtatgcttcgcaatctttcaagttac
tattacaaagaagctgcgcatctgttttgtgtaagaattgctcaaggacttgttcacctt
gggaagggtttgttgactctctctccataccattctgaccggtttctactttccccaatg
gcccttggaggccttgttactgtattgcatgcttgcctcgatatgaaatccaccattcta
gggaaataccactacattctttacattatcgtcttggcgatgcagcctagaatgctttta
acggtggatgaggatctaaagcccctatctgttccagtacgggttgggcaagctgttgat
gtggttggtcaggctggaaggcccaagacaattactggtttccaaacacattcgacaccc
gtattgcttgcagcaggggaacgggctgaattagcaaccgaaaaatacattccgctgact
tcggtattggagggctttgtaattctgaagaagaacccggaatataacgaggagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341960
Entry
4341960           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 2 homolog A isoform X1
  KO
K03028  26S proteasome regulatory subunit N1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4341960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4341960
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4341960
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2 ATP-cone
Other DBs
NCBI-GeneID: 4341960
NCBI-ProteinID: XP_015643124
UniProt: B9FQQ6 A0A8J8YL10
LinkDB
Position
6:complement(29423345..29431640)
AA seq 901 aa
MPPREDPNGDASSASPSDPVPPPPQQPQPQPAKGKGKKKDEKKDDDLSEEDQALKEQLEL
YVVRAQDTDPGVQKLALESMRQEIRSATSSMTSVPKPLKFLRPHYGTLKAYFETMPESDL
KKYMADILSVLALTMSAEGERESLNYRMIGSEGDIGSWGHEYVRNLAGEIAQEFQKRQDD
GMPTDSLKELVEQIVSFHMKHNAEPEAVDLLMEVEKLDLLVKHVDSTNYKRTCLYLTSSS
KYLPAPDDMSALKIAFEIYMKFGDFANALRIALLLYDKSLELKPIFTATDDFQLKKQFAF
IIARHGLSIEIDDDIAADENEKEALQDIISNIKLSEGYLTLARDIEVMEPKSPEDIYKVH
LIDGRGATSSSLDSARQNLAATFVNAFVNAGFGQDKLMTTPSDSSSSGSSGNWLFKNKEH
GKASAAASLGMILLWDSDSGLAQLDKYLHSNDIHVVAGALLGIGIVSCGVKSDCDPAFAL
ISEYFSRDESIIRIGAILGLGIAYAGSQKEEVRENLTAFLTDSQVPLEVLVFSAISLGLV
FVGSCNEEVAQTIICVLMERSEPELAEPIMRLLPVALGLLYLGKQESVEATAEVSKTFDE
KIRNYCDVTLMSLAYAGTGNVLKVQKLLGICSEHLEKGETHQGPAVLGISLIAMAEELGA
EMAVRSLERLLQYGEQNIRRAVPLALGLLCISNPKVNVMDTMSRLSHDADAEVSMAAIIS
LGLIGAGTNNARIAGMLRNLSSYYYKEAGHLFCVRIAQGLVHLGKGLLTLSPYHSDRFLL
SPIALAGLVTVLHACLDMKSIILGKYHYMLYILTLAMQPRMLLTVDEDLKPLSVPVRVGQ
AVDVVGQAGRPKTITGFQTHSTPVLLAAGERAELATEKYLPLTPVLEGFVILRKNPEYHE
D
NT seq 2706 nt   +upstreamnt  +downstreamnt
atgccgccgcgcgaggaccccaacggggacgcctcctccgcctccccctcggaccccgtc
ccgcctccgccgcagcagccgcagccgcagccggccaagggcaaggggaagaagaaggat
gagaagaaggacgacgacctgtcggaggaggaccaggcgctcaaggagcagctcgagctc
tacgtggtgcgggcgcaggacaccgatcccggcgtccagaagctcgccctcgagagcatg
aggcaggagatccgttctgcgacaagttcaatgacctctgtcccaaagcctctcaaattc
cttcgcccgcactatggaactctcaaggcttactttgagacaatgccagaatctgatctg
aagaagtatatggctgatattttgtcagtattggccctgacaatgtccgctgaaggagaa
agagagagcctcaactaccgaatgataggctctgaaggtgacattggttcatggggtcat
gaatatgtgagaaacttggctggtgaaattgcacaggaattccagaagcgccaggatgat
ggcatgccaactgattccctgaaggaactggtggagcaaatcgtttcattccacatgaag
cataatgctgaacctgaagctgtggatcttctaatggaggtcgaaaagcttgatttgcta
gttaagcacgttgactccacgaactacaaaaggacctgcttgtacctcactagttcttct
aaatatcttcctgctcctgatgacatgtcggcacttaaaatagcttttgagatttacatg
aaatttggagattttgcaaatgctttgcgtattgcacttctgctttatgacaagtccctg
gagttgaagccgatttttacagcaactgatgattttcaactgaagaagcaattcgcgttt
atcatagcacgccatggtttaagcatcgagattgatgatgacatagctgctgatgaaaat
gagaaggaggctttgcaggacataatttctaatattaaattgagtgaggggtaccttaca
cttgcacgagatattgaggtcatggagccaaaatctccagaagacatatataaggttcat
ttgattgatggccgaggggctacaagctccagtcttgattccgcaagacagaatctggcg
gcaacatttgtcaatgcattcgtgaatgctggatttggccaggataaactcatgaccaca
ccatcagattcttcaagcagtggttcttctggaaactggttattcaagaacaaggaacat
gggaaagctagtgcagccgctagcctgggaatgattcttctgtgggattctgattcagga
cttgcccaacttgacaagtacctgcacagcaatgatattcatgttgttgctggggctttg
ctagggattggaattgtttcttgtggtgtgaagagtgactgtgatccggcatttgctctc
atttctgagtatttcagcagggatgagtcaattatacgaattggagcaatccttggtctt
ggtattgcttatgctggctcccagaaagaggaggttagagagaatctcacagcttttctg
actgactcccaagtacctctggaggtcttggtcttctctgccatctccttaggtttggtg
ttcgttggttcctgtaatgaagaggttgcacagacaatcatatgcgtcttaatggagcgt
agtgaaccagagcttgcagagccaattatgcgcttgcttcctgttgcccttggccttcta
tatcttggaaagcaggaaagtgtggaggcgactgcagaggtttctaaaacctttgatgag
aagataaggaattattgtgacgtgacattgatgtcactggcatatgctgggacagggaac
gtgcttaaggttcagaaactccttggaatttgctccgagcatcttgagaaaggtgaaacc
caccaagggccagcagttcttggaatctccctaattgccatggctgaagaattaggggcg
gaaatggctgtacgttcccttgagcgtcttttacagtatggcgagcagaatattagaagg
gcggttcctctagctctgggtttgctttgcatatccaatccaaaggtaaatgttatggac
acaatgagtagactgagccatgatgcagatgcggaagtttctatggctgcaatcatctcc
ctgggcttgataggggctggtacaaacaatgcccgtatagctgggatgcttcggaacctc
tcaagttattattacaaagaagcaggacatctgttttgtgtgaggattgctcaaggtctt
gttcaccttgggaagggtttgctgaccctttcaccatatcactctgaccggttccttctg
tcccccatagcacttgctggtcttgtgacggttctgcatgcctgtcttgacatgaaatcc
atcattctggggaagtaccattacatgctttatatccttaccctagctatgcagcctagg
atgctattgactgtggatgaggatctcaagcccctctctgttccggtacgtgttggccaa
gcagttgatgtcgtcggtcaggcaggtagacccaagacaatcactggattccagacacat
tcaacgcctgtattacttgctgcaggggagcgagcagagctggcaactgaaaaatatctt
ccactgacaccagttcttgagggttttgtgatcctaaggaagaacccagaataccatgaa
gattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346741
Entry
4346741           CDS       T01015                                 
Name
(RefSeq) 26S proteasome non-ATPase regulatory subunit 2 homolog A
  KO
K03028  26S proteasome regulatory subunit N1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4346741
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4346741
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     4346741
SSDB
Motif
Pfam: RPN1_RPN2_N RPN1_C PC_rep HEAT_2 ATP-cone
Other DBs
NCBI-GeneID: 4346741
NCBI-ProteinID: XP_015612484
UniProt: Q6K2Q1 Q0J2L4
LinkDB
Position
9:9620360..9628461
AA seq 891 aa
MPPRKDPNGGAFPSEPAPPQPAKAKGKKKDENKDDDLSEEDQALKEQLELYVVRAQDPDP
GVQKLALESMRQEIRSATSSMTSVPKPLKFLRPHYGILKAYFETMPESELKKYMADILSV
LALTMSAEGERESLKYRMIGSEGDIGSWGHEYVRNLAGEIAQEFQKRQDDGMTTDSLKEL
VEQIVSFHMKHNAEPEAVDLLMEVEKLDLLVKHVDSTNYKRTCLYLTSSSKYLPAPDDMS
ALKIAFEIYMKFGDFANALRIALLLDDKSLELKQIFTATDDFHLKKQFAFIIARHGLSTD
IDDDIAADENEKEALQDIISNIKLSEGYLTLARDIEVMEPKSPEDIYKVHLIDGRGATSS
SLDSARQNLAATFVNAFVNAGFGQDKLMTAPSDSSGSGSSGNWLFKNKEHGKASAAASLG
MILLWDSDSGLAQLDKYLHSNDIHVVAGALLGIGIVSCGVKSDCDPAFALISEYFSRDES
IIRIGAILGLGIAYAGSQKEEVRENLTAFLSDSQVPLEVLVFAAISLGLVFVGSCNEEIA
QTIICVLMEHSEPELAEPIIRLLPVALGLLYLGKQESVEATAEVSKTFDEKIRNYCDVTL
MSLAYAGTGNVLKVQKLLGICSEHLEKGETHQGPAVLGISLISMAEELGAEMAVRSLERL
LQYGEQNIRRAVPLALGLLCISNPKVNVMDTMSRLSHDADAEVSMAAIISLGLIGAGTNN
ARIAGMLRNLSSYYYKEAGHLFCVRIAQGLVHLGKGLLTLSPYHSDRFLLSPIALAGLVT
VLHACLDMKSIILGKYHYMLYILALAMQPRMLLTVDEDLKPLSVPVCVGQAVDVVGQAGR
PKTITGFQTHSTPVLLAAGERAELATEKYLPLTPVLEGFVILRNNPEYHED
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgccgccgcgcaaggaccccaacgggggcgccttcccctcggagcccgccccgccgcag
ccggccaaggccaaggggaagaagaaggatgagaacaaggacgacgacctgtcggaggag
gaccaggcgctcaaggagcagctcgagctctacgtggtgcgggcgcaggaccccgatccc
ggcgtccagaagctcgccctcgagagcatgaggcaggagatccgttctgcgacaagttca
atgacctctgtcccaaagcctctcaaattccttcgcccgcactatggaattctcaaggct
tactttgagacaatgccagaatctgagctgaagaagtatatggctgatatcttgtcagta
ttggccctgacaatgtccgctgaaggagaaagagagagcctcaagtaccgaatgataggc
tctgaaggtgacattggttcatggggtcatgaatatgtgagaaacttggctggtgaaatt
gcacaggaattccagaagcgccaggatgatggcatgacaactgattccctgaaggaactg
gtggagcaaattgtttcattccacatgaagcataatgctgaacctgaagctgtggatctc
ctaatggaggtcgaaaagcttgatttgctagttaagcacgttgactccacaaactacaaa
aggacctgcttgtacctcactagttcttctaaatatcttcctgctcctgatgacatgtcg
gcacttaaaatagcttttgagatttacatgaaatttggagattttgcaaatgctttgcgt
attgcacttctgcttgatgacaagtctctggagttgaagcagatttttacagcaactgat
gattttcacctgaagaagcaattcgcgtttatcatagcacgccatggtttaagcaccgac
attgatgatgacatagctgcagatgaaaatgagaaggaggctttgcaggacataatttct
aatattaaattgagtgaggggtaccttacacttgcacgagatattgaggtcatggagcca
aaatctccagaagacatatataaggttcatttgattgatggccgaggggctacaagctcc
agtcttgattctgcaagacagaatctggcggcaacatttgtcaatgcattcgtgaatgct
ggatttggccaggataaactcatgaccgcaccatcagattcttcgggcagtggttcttct
ggaaactggttattcaagaacaaggaacatgggaaagctagtgcagccgctagtctggga
atgattcttctgtgggattctgattcaggacttgcccaacttgataagtacctgcacagt
aatgatattcatgttgttgctggggctttgctaggtattggaattgtttcttgtggtgtg
aagagtgactgcgatccggcatttgctcttatttctgagtatttcagcagggatgagtca
attatacgaattggagcaatccttggtcttggtattgcttatgctggctcccagaaagag
gaggttagagagaatcttacagcttttctgagtgactcccaagtacctctggaggtctta
gtcttcgctgccatctccttaggtttggtgttcgttggttcttgtaatgaagagattgca
cagacaatcatatgtgtcttaatggagcatagtgagccagagcttgcagagccaattata
cgcttgcttcctgttgcccttggccttctatatcttggaaagcaggaaagtgtggaggcg
accgctgaggtttctaaaacctttgatgagaagataaggaattattgtgacgtgacactg
atgtcgctggcatatgctgggacagggaacgtgcttaaggttcaaaaactccttggaatc
tgttccgagcatcttgagaaaggtgaaacccaccaaggaccagcagttcttggaatctcc
ctaatttccatggctgaagaattaggggcggaaatggctgtacgttcccttgaacgtctt
ttacagtatggcgagcagaatattagaagggcggttcctctagctctgggcttgctttgc
atatccaatccaaaggtaaatgttatggacacaatgagcagactgagccatgatgcagat
gcggaagtttctatggctgcaataatctccctgggcttgataggggctggtacaaacaat
gcccgaatagctgggatgcttcggaacctctcaagttattattacaaagaagcaggacat
ctgttttgtgtgaggattgctcaaggtcttgttcaccttgggaagggtttgctgaccctt
tcgccatatcactctgaccggttccttctgtcccccatagcacttgctggtcttgtgacg
gttctgcatgcctgccttgacatgaaatccatcattctggggaagtaccattacatgctt
tatatccttgccctagctatgcagcctcggatgctattgactgtggatgaggatctcaag
cccctctctgttccggtttgtgttggtcaagcagttgacgtcgtcggtcaggcgggtcga
cccaagacaattactggattccagacgcattcaacgcctgtattacttgccgcaggggaa
cgagcagagctggcaactgaaaaatatcttccactgacaccagttcttgagggttttgtg
atcctaagaaataacccagagtatcatgaagattaa

DBGET integrated database retrieval system