KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328313
Entry
4328313           CDS       T01015                                 
Name
(RefSeq) putative adagio-like protein 2
  KO
K12115  clock-associated PAS protein ZTL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4328313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4328313
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4328313
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_6 Kelch_5 Kelch_1 Kelch_2 PAS_9 F-box-like PAS PAS_3 F-box PAS_4 PAS_8
Other DBs
NCBI-GeneID: 4328313
NCBI-ProteinID: XP_015625446
UniProt: B7F9U6
LinkDB
Position
2:2798797..2803774
AA seq 623 aa
MEWDSDSEGSGDEEEEEEEEEEEGVEVGGGGDGGVGVGVGGGFALAIEGVLGACGLVVSD
ALEPDFPIIYVNRGFEDATGYRAEEVLGRNCRFLQCRGPFAKRRHPLVDTTVVTDIRRCL
EEGTVFQGDLLNFRKDGSPFMAKLQLTPIYGDDETITHYMGMQFFNDSNVDLGPLSVSTT
KEIVRSTLITPDNTIRPSPMGKGFCSEHSDLFLLSDEVLCQKILSRLSPRDIASVNSVCK
RLYHLTRNDDLWRMVCQNAWGSEATQVLETVAGTRSLAWGRLARELTTLEAVTWRKLTVG
GAVEPSRCNFSACAAGNRVVLFGGEGVNMQPMNDTFVLDLNASKPEWRHINVRSAPPGRW
GHTLSCLNGSRLVLFGGCGRQGLLNDVFMLDLDAQQPTWREIPGLAPPVPRSWHSSCTLD
GTKLVVSGGCADSGVLLSDTYLLDVTMERPVWREIPASWTPPCRLGHSLSVYDGRKILMF
GGLAKSGPLRLRSNDVFTLDLSENKPCWRCITGSGMPGASNPAGVGPPPRLDHVAVSLPG
GRILIFGGSVAGLHSASKLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVGGTKAIVL
GGQTGEEWTLTELHELSLVSSLV
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggagtgggacagcgactcggaggggagcggagacgaggaggaggaggaggaggaggag
gaggaggagggggttgaggtggggggaggtggggatgggggcgtgggcgtgggagtcggt
gggggattcgcgctggcgatcgagggggtgctgggcgcgtgcgggctggtggtgtcggac
gcgctggagccggatttccccatcatctacgtcaaccgcggcttcgaggacgccaccggg
taccgcgccgaggaggtgctcgggaggaactgtcgattcttgcagtgtagaggaccattt
gctaagaggagacatccccttgttgatactacagtagttactgacattcggagatgctta
gaggaaggcactgtgttccagggcgatctgctgaactttaggaaagatggttctccattc
atggcaaagctccagttaacacccatttatggagatgacgaaacaataacccactatatg
ggcatgcagttcttcaatgactctaatgttgatttggggccattgtctgtctctacaaca
aaggagattgtgagatctactttgattacaccagataacaccatccgaccaagtccaatg
gggaagggcttctgctcagagcattctgatcttttcctattgagtgatgaggtactttgc
cagaagatcctatcaagattatcgcccagggatatagcatctgtaaactctgtatgtaaa
cggctgtaccacttaacaaggaatgacgacctttggagaatggtttgtcagaatgcatgg
ggcagtgaagcaactcaagttcttgagactgtggctggaacaagaagtttggcatggggg
cggttagcaagagagttgaccaccctggaagctgtcacctggaggaaattgactgttggg
ggtgcagtggagccttctcgctgcaacttcagcgcttgtgcggcagggaaccgtgttgtc
ctttttggaggggaaggtgttaacatgcagccaatgaatgatacatttgtgcttgatttg
aatgccagcaagccagaatggaggcacatcaatgtgagatcggctcctcctgggcgctgg
ggtcataccctttcttgcctaaatggatcacggttggttttgtttggtggttgtggaagg
cagggcctgctcaatgatgtgttcatgttggatttggatgcacagcaaccaacttggcgt
gagattcctggccttgcaccaccagttccacggtcatggcatagttcttgcacattggat
ggaacaaaattggtggtatctggtggctgtgctgattctggtgtgcttctcagtgacacg
tatcttttggatgtaacaatggaaagacctgtttggagggagatacctgcatcttggact
ccaccttgtagattggggcactcgctctctgtctacgatggcaggaaaatcctgatgttt
ggtggtcttgctaaaagcggtcctctacgactaaggtctaatgatgtgttcacattggat
ttaagtgaaaataagccatgctggcggtgtatcaccggcagtggaatgccaggagccagt
aatccagctggagttggtccaccccctcgccttgaccatgtcgctgtgagccttcctgga
gggagaattttgatatttggtggatcagtggcaggtcttcactccgcttcaaagctttac
ctgctggatccgactgaagagaagcctacctggaggatactgaatgttcctggccgccct
ccgcgatttgcctggggccacagtacctgtgttgtgggaggtacaaaggcgatagttctt
ggaggacaaactggagaggagtggacactaactgaactgcatgagctttctctggtaagc
tctttagtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341923
Entry
4341923           CDS       T01015                                 
Name
(RefSeq) adagio-like protein 1
  KO
K12115  clock-associated PAS protein ZTL
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4341923
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4341923
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     4341923
SSDB
Motif
Pfam: Kelch_4 Kelch_3 Kelch_2 Kelch_5 Kelch_1 Kelch_6 PAS_9 F-box-like PAS_3 PAS F-box F-box_5 PAS_4
Other DBs
NCBI-GeneID: 4341923
NCBI-ProteinID: XP_015643178
UniProt: Q5Z8K3
LinkDB
Position
6:complement(28969543..28974580)
AA seq 630 aa
MEWDSESDGAGSIGAGEEEEEEEEEEEGGFGGGGGGGGGGGGMFSFAIEGMLRASGPCGL
VVTDALEPDCPIIYVNCGFEEATGYRAEEVLGRNCRFLQCRGPFAQRRHPLVDAMVVSEI
RKCIDNGTEFRGDLLNFRKDGSPLMNKLHLTPIYGDDETITHYMGIQFFTNANVDLGPLP
GSLTKEPVRSTRFTPDNFFRPISTGPGQSNFCREYSSLFQLTDEVLCQSILSRLSPRDIA
SVSSVCRRLYLLTRNEDLWRMVCQNAWGSETTRALETVPAAKRLGWGRLARELTTLEAVA
WRKLTVGGAVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNASNPEWRHVNVS
SAPPGRWGHTLSCLNGSLLVVFGGCGRQGLLNDVFTLDLDAKQPTWREIPGVAPPVPRSW
HSSCTLDGTKLVVSGGCADSGVLLSDTYLLDVTMDKPVWREVPASWTPPSRLGHSMSVYG
GRKILMFGGLAKSGPLRLRSSDVFTMDLSEEEPCWRCLTGSGMPGAGNPAGAGPPPRLDH
VAVSLPGGRVLIFGGSVAGLHSASQLYLLDPTEEKPTWRILNVPGRPPRFAWGHSTCVVG
GTKAIVLGGQTGEEWMLTEIHELSLASSTV
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggagtgggacagcgagtcggacggcgccggcagcatcggcgccggcgaggaggaggag
gaggaggaagaggaggaggagggtggttttgggggaggaggtggtggtgggggcggcggc
ggagggatgttctcgttcgcgattgaagggatgctgcgcgcttcggggccgtgcgggctc
gtcgtcaccgacgcgctcgagcccgactgccccatcatctacgtcaactgcgggttcgag
gaggccacgggataccgcgcggaggaggtgctcggcaggaactgccgattcctgcaatgc
agaggaccctttgcgcaaaggagacatcccctagttgatgccatggtggtttctgagatt
cgcaaatgcatagacaatggtaccgaattccgtggtgatttgctaaatttcaggaaagat
ggctctccattgatgaacaagttacacctgacccctatatatggagatgatgagaccata
actcattacatgggcattcagttcttcaccaatgctaatgttgatttgggaccattgcct
ggctcattgacgaaggaacctgtcagatctacaagatttactccagataactttttccgg
cccatatccactggaccagggcagagcaacttctgccgggaatattctagcctgttccag
ttgactgatgaagtactctgccagagtatcctgtcaaggttgtcaccaagagatatagca
tctgttagctctgtgtgtaggcggttgtatctcttgacaagaaatgaagatctttggaga
atggtttgtcagaatgcatggggcagtgagactactcgagctcttgagactgtccctgcg
gcaaaaagattaggctggggtcgattggcaagagagctgaccacactggaagctgttgct
tggaggaagttgacagttgggggtgccgtggagccatctcgatgtaacttcagtgcctgt
gctgtagggaatcgtgttgttctctttggtggggaaggtgttaacatgcaaccaatgaat
gacacatttgtgttggatttgaatgctagcaatccagaatggaggcatgtcaatgtaagc
tcagctcctcctggccgttggggccataccctatcatgcctaaatggatcgctgttagtt
gtgtttggtggatgtggaagacagggcctgcttaatgacgtgttcacattggatttggat
gcaaaacagccgacctggcgcgagattcctggagttgcaccaccagttccacgttcatgg
cacagctcctgcactttagatgggacgaagttggtggtttctggtggctgtgcagactca
ggtgtactactcagtgatacatatcttcttgatgtaacgatggacaaacctgtgtggagg
gaggtacctgcatcttggacgccaccttcgagattgggccactcaatgtctgtctatggt
ggcaggaaaattttgatgtttggtggtcttgctaagagtggtccactgcgactccggtca
agtgatgtgttcacaatggacttaagtgaagaggaaccctgctggcggtgcctcaccggt
agtggaatgcctggggcaggaaatccagccggagctggtccacctcctcgccttgatcat
gttgctgtcagcttacctggggggagagttttgatatttggtggatcagtggcaggtctt
cattcagcgtcacagctttatctcttggatccaactgaagaaaagcctacctggaggata
ctgaatgttcctgggcgacccccacggtttgcctggggccacagcacctgtgttgttgga
ggaacaaaagcaatagtgcttggaggacaaactggagaagagtggatgttaaccgaaatc
catgagctttctttggctagcagcacagtttga

DBGET integrated database retrieval system