KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328363
Entry
4328363           CDS       T01015                                 
Name
(RefSeq) EH domain-containing protein 1
  KO
K12483  EH domain-containing protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328363
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328363
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4328363
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4328363
SSDB
Motif
Pfam: DUF5600 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 EF-hand_4 GTP_EFTU EF-hand_7 AAA_28 AAA_24 TsaE AAA_16 DNER_C Septin
Other DBs
NCBI-GeneID: 4328363
NCBI-ProteinID: XP_015623964
UniProt: A0A0N7KEQ5
LinkDB
Position
2:complement(3166614..3170873)
AA seq 543 aa
MELARSACSKEHHKIYAGWFAVADPDGDGRVTGADATKFFAMSGLSRADLKQVWAIADTK
RQGFLGFGEFVAAMQLVSLAQAGEEITQDSLKREDLSSLDPPVMEGLDELLARSKAGVKR
VHPEENGAPQVQVHSANSWFSSKSAKKMQVPLTAVTSVIDGLKRLYVEKLKPLEVAYRFN
DFASPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLQTSYPGAHVGPEPTTDRFVVVMSG
SDERTIPGNTIAVQADMPFTGLTTFGGAFLSKFECSQMPHPLLDHITFVDTPGVLSGEKQ
RTQRSYDFTGITSWFAAKCDLILLLFDPHKLDISDEFKRVIASLRGHDDKIRVVLNKADQ
VDTQQLMRVYGALMWSLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKDLFEKEQDDLL
CDLKDIPKKACDRRVNEFVKRARAAKIHAYIIGHLKKEMPAMMGKAKAQQRLIDNLGDEF
AKVQREYHLPAGDFPDVEHFKEVLGGYNIDKFEKMKPKLVQAVDDMLAYDIPELLKNFRN
PYE
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggagctcgcgcgatcggcctgctccaaggagcaccacaagatctacgccggctggttc
gccgtcgccgacccagatggagatgggcgtgtcacgggtgctgatgctaccaagttcttc
gccatgtccggcctgtcccgcgccgacctcaagcaggtctgggcgatcgcggacaccaag
cggcaggggttcctcggcttcggcgagttcgtcgccgcgatgcagctcgtgtcactggcg
caagcgggggaggagatcactcaggacagtctgaagcgcgaagacctgagtagtttggat
ccacctgtgatggaaggtcttgacgaactacttgcgagatcaaaggctggggtaaagaga
gtacacccagaagaaaatggcgcccctcaggttcaagtgcattctgctaatagctggttc
agttcaaaatcagcaaagaagatgcaggtccccctgactgctgttacttctgtaattgat
ggcttaaaaagactatacgtagaaaaactgaagcctctggaggttgcataccggttcaac
gattttgcttccccgttattgacaagcagtgattttgatgcaaaaccaatggttatgctc
ttgggtcaatattctacagggaaaacaactttcattaagcatctgctgcaaacaagttat
ccaggagctcatgttggaccagagcccactactgaccgatttgttgttgtcatgtctgga
tctgatgaaaggactattcctggcaatactattgctgttcaagctgatatgccattcact
ggtcttacgacatttggcggtgcttttctgtcaaagttcgagtgctctcagatgccacat
ccgctgctcgatcatatcacctttgtggacacccccggtgtcctgtctggtgaaaagcag
cggacgcagcgtagctatgatttcaccggcataacttcatggtttgctgctaagtgtgac
cttattcttcttctgtttgatcctcataagcttgatatcagtgatgagttcaaacgtgtg
attgcatctttacgtggccatgatgacaaaatacgtgtagtgctgaataaggcagaccaa
gttgacactcagcagcttatgagagtgtatggtgcactgatgtggtctcttgggaaagta
ctcaatacccctgaggtcgcgcgtgtttatatcgggtcattcaatgacaaaccagtgaat
gaatcagctgttggaccaattggaaaggacttgtttgagaaagagcaagatgatctcctc
tgtgatctgaaagacatacccaagaaggcctgtgatcgtcgggtcaacgagtttgttaaa
cgtgctagagctgctaagattcatgcttacataattggccatctaaagaaggagatgcct
gcaatgatggggaaagctaaggctcaacagcgactcatagacaacctgggtgatgagttt
gcaaaggtccaaagggagtaccatcttccagccggagacttccctgacgttgagcacttc
aaggaggtgttgggtgggtacaacatcgacaagttcgagaagatgaagcccaagctggtg
caggccgtggacgacatgctcgcgtacgacatcccggagctcctcaagaacttcaggaac
ccttacgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337342
Entry
4337342           CDS       T01015                                 
Name
(RefSeq) EH domain-containing protein 1
  KO
K12483  EH domain-containing protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4337342
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4337342
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4337342
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4337342
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4337342
SSDB
Motif
Pfam: DUF5600 Dynamin_N EHD_N MMR_HSR1 EF-hand_7 EF-hand_1 EF-hand_4 EF-hand_6 GTP_EFTU Roc AAA_28 DUF4201 AAA_16 TsaE EF-hand_5 DNER_C
Other DBs
NCBI-GeneID: 4337342
NCBI-ProteinID: XP_015633605
UniProt: A0A0P0WG62
LinkDB
Position
4:34138211..34142132
AA seq 542 aa
MGSDSPPKKWGLREQREAYLRWFSLADDDGDGRVTGKDALKFFAMSNLSRPELKQVWAIA
DSKRQGYLGFSEFMTAMQLVSLAQAGNEISQDTLAHADLETLLPPTMEGLDKKLKNNSMS
KSNSDIVVRHPSELPASANWFNSKSGKKIPLRSVTSIIDGLKKSYIEKLRPLEKTYQFDD
FVSPLLTSSDFDAKPMVMLLGQYSTGKTTFIKHLLKTNYPGAHIGPEPTTDRFVVITSGP
DERCIPGNTIAVQADMPYSGLSSFGTAFLSKFECSQMPHPLLDHITFVDTPGVLSGEKQR
TQRSYDFTGVTSWFAAKCDLILLLFDPHKLDISDEFKRVIGSLKGHDDKIRIVLNKADQV
DAQQLMRVYGALLWSLGKVLNTPEVMRVYIGSFNDKPIRETVAGPLGKELFEKEQEDLLS
DLNDIPKKACDRRINEFVKRSRSAKVHAHIISHLKKEMPALMGKAKAQQRLLDTLDEQFA
KVQKELHLPAGDFPSVDEYRETLSAYNFDKFERLKPKLVQGVDDMLAYDIPDLLKSFRNP
YE
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggatcggactcgccgcccaagaaatggggcctcagggagcagcgcgaagcctacctc
cggtggttctccctcgccgacgacgatggagatgggcgcgtgacggggaaagacgcgctc
aagttcttcgccatgtcgaatctctcccgccccgagctgaagcaggtctgggcaatcgct
gattccaagcgtcagggttatcttggattctcggagtttatgaccgcaatgcagctggtt
tctcttgcacaagctgggaatgagattagtcaggacacccttgcacatgcagatttggag
acgttgctacctccgacaatggaaggtctggacaaaaaactaaaaaataattctatgagc
aagagcaactctgatattgtcgtacgtcatccgtcagaattgcctgcatcagccaactgg
tttaactccaagtcaggaaagaagattcctttaagatcagttacttcgatcatcgatggg
ttaaagaaatcttacattgagaagttgaggccactagaaaaaacatatcagttcgatgac
tttgtttcacctttgctgactagcagtgatttcgatgcgaagccaatggtcatgttgctg
ggtcagtattccacaggaaaaaccacattcataaagcatttactgaagacaaattatcca
ggtgctcatattggtccagagcctacaactgacagatttgttgttattacttctggacct
gatgaaagatgcatccctggaaacacaattgccgtgcaagcagacatgccatatagtggc
ttgtcatcttttgggacagcatttctatcaaagtttgaatgttctcagatgcctcatcca
ctactggatcatataacctttgtggacactcctggagttttatcaggggaaaagcagcga
acacagcgtagctatgacttcactggagttacatcatggtttgcagccaagtgtgaccta
attcttctcctatttgatccacataagcttgacatcagtgatgagttcaagcgtgtaatt
gggtcactcaaagggcatgatgataaaatacgtatagttctgaacaaagcagaccaagtt
gatgcacaacaactcatgagagtctatggagcactgctatggtcgcttgggaaagttctg
aacacaccagaagtcatgcgtgtgtacataggttcatttaacgacaagcccattagggag
acagtagctgggccactgggtaaagaactgtttgagaaagaacaagaagacctgctctcc
gacctgaatgacattccaaagaaagcctgtgaccgtcgaatcaacgaattcgtgaagcgt
tcgaggtcagccaaggtccatgctcacataatcagccacctgaagaaggagatgccggcg
ctgatgggcaaggccaaggcgcagcagcggctgctcgacaccctcgacgagcagttcgcc
aaggttcagaaggagctgcacttgccggccggcgacttccccagcgtggatgagtacagg
gagacactgagcgcctacaacttcgacaagttcgagaggctgaagcccaagctggtgcag
ggcgtcgacgacatgctcgcctacgacatccccgatctcctcaagagcttcaggaacccc
tacgaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341894
Entry
4341894           CDS       T01015                                 
Name
(RefSeq) EH domain-containing protein 1
  KO
K12483  EH domain-containing protein 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341894
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341894
Membrane trafficking [BR:osa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    4341894
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4341894
SSDB
Motif
Pfam: DUF5600 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 EF-hand_4 EF-hand_7 GTP_EFTU EF-hand_6 EF-hand_5 NPA AAA_28 TsaE DNER_C TniB AAA_16
Other DBs
NCBI-GeneID: 4341894
NCBI-ProteinID: XP_015644272
UniProt: Q655B1 Q653F5
LinkDB
Position
6:28688754..28693925
AA seq 544 aa
MEIGQHPASGYSKEHQKTYQEWFAFADSDGDGRITGPDAIKFFAMSKLPRADLKQVWAIA
DSKRQGYLGFSEFVTAMQLVSLAQAGDEITQDSLKRDDLGSLNPPTMDGLDALLVKSKHH
AKRVDPDIDGFPQAQSPATSQWFSSKSSKKIPLNAVTSVIDGLKKLYIEKLKPLEVTYKF
NDFVSPLLTNSDFDAKPMVMLLGQYSTGKTTFIKHLLRTSYPGAHIGPEPTTDRFVVVMS
GPDERTIPGNTIAVQADMPFSGLTTFGTAFLSKFECSQMPHPLLEHITFVDTPGVLSGEK
QRTQRSYDFTGVTSWFAAKCDLILLLFDPHKLDISDEFKRVIGSLRGHDDKIRVVLNKAD
QVDTQQLMRVYGALMWSLGKVLNTPEVARVYIGSFNDKPVNESAVGPIGKELFEREQDDL
LSDLKDIPKKACDRRINEFVKRARAAKIHAHIIGHLKKEMPAMMGKAKAQQRLIDNLENE
FAKVQREQHLPAGDFPYVEHFRDVLGGYSIDKFEKIKPKMVQAVDDMLGYDIPELLKNFR
NPYE
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggagatcgggcagcatccggcgagcggctactccaaggagcaccagaagacctaccag
gagtggttcgccttcgccgactcagatggcgacgggcgcatcacggggcccgacgccatc
aagttcttcgccatgtccaagctcccccgcgccgacctcaagcaggtttgggcaatcgcg
gactccaagcggcaggggtacttaggtttcagcgaattcgtcacggcaatgcagcttgtc
tctctggcgcaagcgggggatgagatcactcaagacagccttaagcgcgatgacttgggc
agcctgaatcctccaacgatggatggtttggatgctctacttgtgaaatcaaagcatcat
gctaagagagttgatccagatatcgatggatttcctcaggctcaatctcctgcaacgagc
caatggttcagctcaaagtcctcaaagaagatacccctgaatgctgttacttctgtcatt
gatgggttaaaaaaactatacatcgaaaaattaaagcctttggaagttacatacaaattc
aatgattttgtatctccattactgacaaatagtgattttgatgcaaagccaatggttatg
cttttaggtcaatattctacagggaaaacaacttttataaaacatctgctcagaacaagc
tatccaggtgcccatattggaccagagccaacaactgacagatttgttgttgtcatgtca
ggaccagatgaaaggactattcctgggaataccatagctgtgcaagcagacatgcctttc
agtggtcttacaacatttggaactgcttttttatccaagttcgaatgctctcagatgcca
catccactactagagcatatcacctttgtcgacacacctggtgttctctcaggcgagaag
caacggacgcaacgtagctatgatttcactggtgtcacatcatggtttgcggccaagtgt
gatcttattcttcttctgtttgatccacataagcttgatatcagtgatgagttcaaacgt
gtcattggatctttacgcggacatgatgacaaaatacgtgtagtgctaaacaaggcagac
caagttgacactcagcagcttatgagagtctatggtgcattgatgtggtctcttgggaaa
gtattgaatacccctgaggttgcacgtgtttatattggatcatttaatgacaaaccagta
aatgaatcagctgttggtccaattggaaaggaactatttgagagagagcaagatgatcta
ctttctgatctgaaagatataccgaagaaagcttgtgaccgtcgaatcaatgaatttgtt
aaacgtgcaagagcagccaagattcatgcccatataattggtcatttgaagaaggagatg
cctgcgatgatgggcaaagccaaagctcagcagcgacttatagacaatttggagaatgag
ttcgcaaaggtccaaagggaacaacatcttccagctggagatttcccttatgtggagcat
ttcagagatgtcctgggtgggtatagcattgacaagtttgagaaaatcaagcccaagatg
gtgcaggcggtggatgatatgcttggatacgacattccagaactcctcaagaacttcagg
aacccatacgagtga

DBGET integrated database retrieval system