KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328392
Entry
4328392           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S14
  KO
K02955  small subunit ribosomal protein S14e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328392
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328392
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4328392
SSDB
Motif
Pfam: Ribosomal_S11 CBM_25
Other DBs
NCBI-GeneID: 4328392
NCBI-ProteinID: XP_015627679
UniProt: Q6H7T1 B9F361
LinkDB
Position
2:complement(3358927..3360783)
AA seq 150 aa
MSKRKTREPKEENVTLGPTVREGEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGMK
VKADRDESSPYAAMLASQDVAQRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALAR
SGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcgaagaggaagaccagggagcccaaggaggagaacgtcactcttggacccactgtc
cgtgaaggagagtatgtgttcggagttgcccacatcttcgcatccttcaatgacactttc
attcatgtcactgacttgtctggaagggaaactcttgttcgcattactggtggcatgaag
gtcaaagctgaccgtgatgagtcatcaccatatgcagctatgcttgcttctcaagatgtt
gcacagcgttgcaaggagcttggtattactgctctgcacatcaagcttcgtgccactgga
ggcaacaagacaaagacacctggtcctggtgctcaatctgctcttagggctcttgctcgc
tctggcatgaagattggtcgcattgaggatgtgaccccggttcccacggacagcacccgc
agaaagggaggtaggagaggaaggaggctgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329563
Entry
4329563           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S14
  KO
K02955  small subunit ribosomal protein S14e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329563
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329563
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4329563
SSDB
Motif
Pfam: Ribosomal_S11 CBM_25
Other DBs
NCBI-GeneID: 4329563
NCBI-ProteinID: XP_015627702
UniProt: A0A0N7KJ13 Q7XSA6
LinkDB
Position
2:complement(19710371..19713542)
AA seq 151 aa
MSGRKKTREPKEENVTLGPTVREGEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGM
KVKADRDESSPYAAMLASQDVAQRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALA
RSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtccgggaggaagaagacacgggagcccaaggaggagaacgtcaccctcggcccgacc
gtgcgcgagggcgagtacgtcttcggcgtcgcccacatcttcgcctccttcaacgacacc
ttcatccatgtcaccgatctgtccgggagggagacgctcgtccgcatcactggtggcatg
aaggttaaagctgatcgcgacgaatcttccccttatgctgctatgcttgcttcacaggat
gttgctcaaagatgcaaggagcttggaataactgctttgcatatcaagctccgtgctact
ggtggtaacaagacaaaaacccctggtcctggtgctcagtccgcacttagagcacttgct
cgatctggcatgaagattggtcgtattgaggatgttactccagtgccgactgatagcaca
cgcagaaagggtggtagaaggggtaggaggctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335791
Entry
4335791           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S14
  KO
K02955  small subunit ribosomal protein S14e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4335791
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4335791
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4335791
SSDB
Motif
Pfam: Ribosomal_S11 CBM_25
Other DBs
NCBI-GeneID: 4335791
NCBI-ProteinID: XP_015633584
UniProt: A0A0N7KJ13 Q7XSA6
LinkDB
Position
4:complement(20432461..20435783)
AA seq 151 aa
MSGRKKTREPKEENVTLGPTVREGEYVFGVAHIFASFNDTFIHVTDLSGRETLVRITGGM
KVKADRDESSPYAAMLASQDVAQRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALA
RSGMKIGRIEDVTPVPTDSTRRKGGRRGRRL
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtccgggaggaagaagacgcgagagcccaaggaggagaacgtgacgctcggccccacg
gtccgcgagggcgagtacgtcttcggcgtcgcgcacatcttcgcgtcgttcaacgacacc
ttcatccacgtgacggatctgtccggcagggagacgctcgtccgcatcaccggtggcatg
aaggtgaaagctgaccgtgatgagtcatccccttatgctgccatgcttgcatcccaggat
gttgcacagagatgcaaggagcttggaattactgctctgcacattaagctccgtgctact
ggtggaaacaagacaaaaactcctggtcctggtgctcaatctgcgcttagagctcttgca
cgttctggcatgaagattggacgcattgaggatgttactccagtcccaactgacagtacc
cgcagaaagggtggcagaagaggaaggaggctgtaa

DBGET integrated database retrieval system