KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328418
Entry
4328418           CDS       T01015                                 
Name
(RefSeq) thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4328418
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4328418
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    4328418
Enzymes [BR:osa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     4328418
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     4328418
SSDB
Motif
Pfam: Rhodanese Reo_sigmaC
Other DBs
NCBI-GeneID: 4328418
NCBI-ProteinID: XP_015625554
UniProt: Q6H4W2 A0A0P0VF65
LinkDB
Position
2:3610943..3614020
AA seq 307 aa
MAQDDSVVSAQWLHEHLGQPDVKVLDASWYMPVEKRDPWQEYQVAHIPGALFFDIDGIVD
LTTDLPHMLPSQEAFAAAVSALDIKNHDKVIVYDGKGFFSAPRVWWMFRVYGHNKIWVLD
GGLPQWRTSGFVLESSTPGDAVQKTKAANSVVERIYNGQLASDVTFQTEFQPHIFWTLEK
VKHNMDAQSHQVVDARSKGRFDGVAPEPREGVRSGHIPGTKCVPFLEMFDDAPMLLPADE
IRKKFEQAGISLDRPIVVTCGSGVTACILALGLYRIGKQDIPVYDGSWTEWEALPDHDYP
KVTSNGS
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcgcaggatgattcggttgtttctgctcagtggctgcatgagcacttagggcagcct
gatgttaaggtgctggatgcttcctggtacatgcctgtagagaagagggatccatggcaa
gaataccaggtggcccatatccctggtgcgctgttcttcgacatagatggcatagttgac
ctgacaactgatttgccacacatgctgccatcacaagaggcttttgcagccgcagtttct
gcgctcgatataaaaaaccatgataaagttattgtttatgatggaaagggatttttcagt
gcacctcgtgtatggtggatgttcagagtttatggacacaataaaatttgggtgttagat
ggaggtttacctcagtggcgaacttctggatttgttcttgagagtagcacccctggtgat
gcagttcagaaaactaaagctgctaacagtgttgttgaaaggatttataatggtcaactg
gcaagtgatgtaacatttcagactgaatttcagcctcatatattctggacactagaaaag
gttaaacataacatggatgcacagtctcaccaagtcgttgatgcccgatcaaagggcaga
tttgatggtgtagcaccagaaccacgggaaggagtaagaagtggacatatcccagggaca
aaatgtgttccattccttgagatgtttgatgatgcaccaatgcttctccctgcagatgag
atccgtaaaaagtttgagcaagcagggatatcccttgatcgccccattgtagtcacttgt
ggatctggtgtaactgcctgcatacttgctttgggactctatagaattgggaagcaagat
attccagtttatgatggatcttggacagaatgggaagctctaccggatcatgattatcca
aaagttacctccaatggttcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352752
Entry
4352752           CDS       T01015                                 
Name
(RefSeq) thiosulfate/3-mercaptopyruvate sulfurtransferase 2 isoform X1
  KO
K01011  thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00920  Sulfur metabolism
osa01100  Metabolic pathways
osa04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    4352752
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4352752
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    4352752
Enzymes [BR:osa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     4352752
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     4352752
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 4352752
NCBI-ProteinID: XP_015620420
LinkDB
Position
12:complement(25702046..25706996)
AA seq 408 aa
MAATLLSRAAAAAAVSLRGARSHHILSSSLPKETLLPPPLLILLATTIASLLAGGRVGWA
RAAEEGAGFGCRASVPAALGGVGSFGIAARCNATSSSAVSEATNALPRTEPVVSAEWLHA
NLKDPDVKVLDASWYMPAEQRNPLQEYQVAHIPGALFFDVDGISDRTSSLPHMLPSEKAF
SAAVSSLGIYNKDGIVVYDGKGLFSAARVWWMFRVFGHDKVWVLDGGLPQWRASGYDVES
SASSDAILKASAAREAIEKVYQGQLVGPSTFEAKLQPHLIWNLDQVKENIDAKTHQLIDA
RGKPRFDGAVPEPRKGIRSGHVPGSKCVPFPQLLDSSQKLLPPEELRKRFEQEGISLDQP
LVSSCGTGVTACILALGLHRLGKTDVPVYDGSWTEWGAHPDTPVATAA
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggccaccctcctctcccgggccgctgccgccgccgccgtctccctccgcggcgcc
cgctcgcaccacatactgtcctcctccctccccaaggaaaccctccttcctcctcccctc
ctcatcctcctcgccaccaccatcgcctcgctcctcgcggggggaagagtcggatgggcg
cgcgccgccgaggagggcgccgggttcgggtgcagggcgtcggtgccggcggcgctgggg
ggcgtcggttcgttcgggatcgcggcgcgctgcaacgccacctcgtcgtcggccgtttcg
gaggctaccaacgcgctgccgaggacggagcccgtggtttcggccgagtggctgcacgcc
aacctcaaggaccccgatgtgaaggtacttgatgcctcttggtatatgcctgccgaacaa
aggaatcctcttcaggagtaccaggtggctcatattcctggggcgctattctttgatgtt
gatggaatatcagacagaacatcaagcttgccgcacatgctgccatctgaaaaggcattt
tctgctgctgtatcttcgcttggaatatacaacaaagatgggatagtagtttatgatgga
aagggactatttagcgctgctcgtgtttggtggatgtttcgtgttttcggacatgataaa
gtttgggtgttggatggtggtttgccccaatggcgtgcttctgggtatgatgttgaatca
agtgcctctagtgatgccatcttaaaagccagtgctgctcgtgaagcaattgagaaagtt
tatcaggggcagttggttggtccctccacatttgaagcaaagttgcagcctcatcttatt
tggaatcttgaccaggtaaaagagaacattgatgccaagacacatcaacttatagatgct
cgaggaaagcctagatttgatggtgcagttccagagccacggaaaggaataagaagtggg
catgtgcctgggagcaaatgtgttcctttccctcagttgcttgacagttcgcaaaagcta
ttacctccagaagagctccgtaaacgatttgaacaagaaggtatatcgcttgatcaaccc
ctggtgtcctcatgtggtactggtgtgacagcatgtatattagctctgggcctccaccgc
cttggcaaaaccgacgttcctgtatatgatggatcatggactgaatggggagcccatcct
gacactccagttgccactgctgcttaa

DBGET integrated database retrieval system