KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328425
Entry
4328425           CDS       T01015                                 
Name
(RefSeq) 4-hydroxyphenylpyruvate dioxygenase
  KO
K00457  4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
Module
osa_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4328425
   00360 Phenylalanine metabolism
    4328425
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4328425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328425
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     4328425
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4328425
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_5 Glyoxalase_3
Other DBs
NCBI-GeneID: 4328425
NCBI-ProteinID: XP_015626163
UniProt: Q6H4V1
LinkDB
Position
2:complement(3677523..3679954)
AA seq 446 aa
MPPTPTPTATTGAVSAAAAAGENAGFRLVGHRRFVRANPRSDRFQALAFHHVELWCADAA
SAAGRFAFALGAPLAARSDLSTGNSAHASLLLRSASVAFLFTAPYGGDHGVGADAATTAS
IPSFSPGAARRFAADHGLAVHAVALRVADAADAFRASVAAGARPAFQPADLGGGFGLAEV
ELYGDVVLRFVSHPDGADAPFLPGFEGVSNPGAVDYGLRRFDHVVGNVPELAPVAAYISG
FTGFHEFAEFTAEDVGTAESGLNSVVLANNAETVLLPLNEPVHGTKRRSQIQTYLDHHGG
PGVQHIALASDDVLGTLREMRARSAMGGFEFLAPPPPNYYDGVRRRAGDVLSEEQINECQ
ELGVLVDRDDQGVLLQIFTKPVGDRPTFFLEMIQRIGCMEKDESGQEYQKGGCGGFGKGN
FSELFKSIEEYEKSLEAKQAPTVQGS
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgcctcccactcccacccccaccgccaccaccggcgccgtctcggccgctgcggcggcg
ggggagaacgcggggttccgcctcgtcgggcaccgccgcttcgtccgcgccaacccgcgg
agcgaccggttccaggcgctcgcgttccaccacgtcgagctctggtgcgccgacgccgcg
tccgccgcgggccggttcgccttcgccctgggcgcgccgctcgccgccaggtccgacctc
tccacggggaactccgcgcacgcctccctcctcctccgctccgcctccgtcgcgttcctc
ttcaccgccccctacggcggcgaccacggcgtcggcgcggacgcggccaccaccgcctcc
atcccttccttctccccaggcgccgcgcggaggttcgccgcggaccacggcctcgcggtg
cacgccgtggcgctgcgcgtcgccgacgcggccgacgccttccgcgccagcgtcgcggcc
ggtgcgcgcccggcgttccagcccgccgacctcggcggtggcttcggcctcgcggaggtg
gagctctacggcgacgtcgtgctccgcttcgtcagccacccggacggcgccgacgcgccc
ttcctcccgggtttcgagggcgtcagcaacccgggcgccgtggactacggcctccgccgg
ttcgaccacgtcgtcggcaacgtgccggagctcgctccggtagccgcgtacatctccggg
ttcaccgggttccacgagttcgccgagttcaccgccgaggacgtgggcaccgccgagagc
ggcctcaactcggtggtgctcgccaacaacgcggagaccgtgctgctgccgctcaacgag
ccggtgcacggcaccaagcggcggagccagatacagacgtacctggaccaccacggcggc
ccgggggtgcagcacatcgcgctggccagcgacgacgtgctcgggacgctgagggagatg
cgggcgcgctccgccatgggcggcttcgagttcttggcgccgccgccgcccaactactac
gacggcgtgcggcggcgcgccggggacgtgctctcggaggagcagatcaacgagtgccag
gagctcggggtgctcgtggacagggatgaccagggggtgttgctccagatcttcaccaag
ccagtaggagacaggccaacctttttcttggagatgatacaaaggattgggtgcatggag
aaggatgagagtgggcaggagtaccagaagggcggctgcggcgggtttgggaagggcaac
ttctcggagctgttcaagtccattgaggagtatgagaaatcccttgaagccaagcaagcc
cctacagttcaaggatcctag

DBGET integrated database retrieval system