KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328446
Entry
4328446           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4328446
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4328446
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328446
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4328446
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     4328446
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4328446
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4328446
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C DapB_N
Other DBs
NCBI-GeneID: 4328446
NCBI-ProteinID: XP_015627707
UniProt: A0A0P0VF84 Q6H703
LinkDB
Position
2:3868104..3872941
AA seq 411 aa
MAQQLSAPFRAAAAAGSRASAAAADPAKVLRLRSAGSAQFTSIAASSSFARNIEPLRAIA
TQAPPAVPQYSSGEKTKVGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFK
YDSTHGPFKGSIKVVDDSTLEINGKKVTITSKRDPADIPWGNFGAEYVVESSGVFTTTEK
ASAHLKGGAKKVVISAPSADAPMFVVGVNEKSYDPKMNVVSNASCTTNCLAPLAKVVHEE
FGIVEGLMTTVHATTATQKTVDGPSMKDWRGGRGAAQNIIPSSTGAAKAVGKVLPELNGK
LTGMAFRVPTPNVSVVDLTCRIEKSASYDDVKAAIKAASEGALKGILGYTDEDVVSNDFV
GDARSSIFDAKAGIGLSSSFMKLVSWYDNEWGYSNRVLDLIAHMALVNAKH
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgcagcagctctccgcccccttccgcgccgccgcggccgccggatcccgcgcctcc
gccgccgccgccgatcccgccaaggtgttacgcttgagaagcgctggctcagctcagttc
acctccatcgcagcttcctcttcatttgctaggaacattgagccgctgagagcgatagct
actcaggcaccccctgccgtcccacaatattcgagtggcgagaagacaaaggttggcatc
aatgggtttgggcgaattgggaggttggtcctgcgtattgcaaccagtagagatgatatt
gaagttgttgctgtcaatgatcctttcattgatgctaaatacatggcctacatgttcaag
tatgactccactcatggtccatttaaaggctccattaaggttgtggatgattcaaccctg
gagatcaatggaaagaaagtcacaatcactagcaaaagagatccagcagatattccttgg
ggtaactttggagctgagtatgttgttgaatcttcaggtgtttttacaacaactgaaaag
gcatcggcacatttgaagggcggtgctaagaaagttgtgatatctgctccatcagcagat
gctccaatgtttgtcgttggagtaaatgagaagagctatgatcctaaaatgaatgttgtt
tctaacgcaagttgtactaccaactgtcttgctcctcttgccaaggttgtccatgaggaa
tttggcattgttgagggtctcatgacaactgttcatgccacaacagccacccagaagact
gtcgatggcccttcaatgaaagattggagaggagggcgtggtgctgctcaaaacataatt
cctagctccactggtgcagccaaggctgttgggaaagtcctccctgagctaaatggaaag
ctcactggtatggccttccgagttccaacaccaaatgtgtctgttgtcgacttgacctgc
cggattgaaaaaagtgcatcctatgacgatgtgaaagcagccatcaaggcagcatcagag
ggtgcactgaaaggtattctaggttacacagatgaggatgtggtttccaatgacttcgtt
ggtgatgcaaggtcaagcatctttgatgccaaggctggtattggactgagctcttccttc
atgaagcttgtgtcatggtatgacaacgagtggggctacagcaaccgtgtgttggatctg
attgcccacatggctcttgtcaacgccaagcactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329892
Entry
4329892           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4329892
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4329892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329892
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4329892
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     4329892
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4329892
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4329892
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4329892
NCBI-ProteinID: XP_015625382
UniProt: Q6K5G8 A0A2H4N016
LinkDB
Position
2:23527124..23530486
AA seq 337 aa
MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTEYMTYMFKYDTVHGQWKHHE
VKVKDSKTLIFGTKEVAVFGCRNPEEIPWAAAGAEYVVESTGVFTDKDKAAAHLKGGAKK
VVISAPSKDAPMFVVGVNEKEYKSDVNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTV
HAITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV
DVSVVDLTVRLEKPASYDQIKAAIKEEAEGKLKGILGYVEEDLVSTDFQGDSRSSIFDAK
AGIALSDTFVKLVSWYDNEWGYSTRVIDLIRHMHSTN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggcaagattaagatcggaatcaatgggttcggccgcatcggcaggctggtggccagg
gtggcgctgcagagcgaggatgtcgagctcgttgccgtcaacgatcccttcatcaccacc
gagtacatgacatacatgttcaagtatgacaccgtccacggccagtggaagcatcatgag
gtcaaggtcaaggactccaagaccctcatctttggcacgaaagaggttgcggtgttcggc
tgcaggaaccctgaggagatcccatgggctgcggctggtgctgaatacgttgttgagtct
actggtgttttcaccgacaaggacaaggcagcagctcacttgaagggtggtgccaagaag
gtcgtcatttctgctcccagcaaagacgcccccatgttcgttgttggtgtcaacgagaag
gagtacaagtctgacgttaacattgtctccaacgctagttgcaccaccaactgcctggct
cctctcgccaaggtcatcaatgacagatttggcatcgttgagggtttgatgaccactgtc
catgccatcactgctacccagaagactgttgatgggccctcgatgaaggactggagaggt
ggaagggctgctagcttcaacatcattcctagcagcactggagctgccaaggctgtcggc
aaggtgcttcctgccctcaatggaaagctgactggaatggctttccgtgttcccacagtc
gatgtttccgttgttgatctgactgttaggcttgagaagcccgccagctatgaccagatc
aaggctgcaatcaaggaggaggctgagggcaagctcaagggcatccttggatacgttgag
gaggaccttgtttccactgacttccagggtgacagcaggtccagcatctttgatgccaag
gctggcattgctttgagcgacacgttcgtgaagcttgtgtcctggtacgacaacgaatgg
ggatacagcacccgtgtgatcgacctgatccgtcacatgcacagcaccaactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336216
Entry
4336216           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4336216
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4336216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4336216
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4336216
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     4336216
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4336216
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4336216
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4336216
NCBI-ProteinID: XP_015635626
UniProt: Q7FAH2
LinkDB
Position
4:24305403..24309060
AA seq 337 aa
MAKIKIGINGFGRIGRLVARVALQSDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHE
VKVKDSKTLLFGEKEVTVFGCRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKK
VVISAPSKDAPMFVVGVNEKEYKPDIDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTV
HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRVPTV
DVSVVDLTVRLEKPASYDQIKAAIKEESEGKLKGILGYVEEDLVSTDFQGDNRSSIFDAK
AGIALNDNFVKLVSWYDNEWGYSSRVVDLIRHMYNTQ
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcgaagattaagatcgggatcaatgggttcgggaggatcgggaggctcgtggccagg
gtggccctgcagagcgacgacgtcgagctcgtcgccgtcaacgaccccttcatcaccacc
gactacatgacatacatgttcaagtatgacactgtgcacggccagtggaagcatcatgag
gttaaggtgaaggactccaagacccttctcttcggtgagaaggaggtcaccgtgttcggc
tgcaggaaccctgaggagatcccatggggtgagactggcgctgagtttgttgtggagtcc
actggtgttttcactgacaaggacaaggccgctgctcacctgaagggtggtgctaagaag
gtcgtcatctctgctcccagcaaggatgcccccatgtttgttgttggtgtcaatgagaag
gagtacaagcctgacatcgacattgtgtccaatgctagctgcaccaccaactgccttgct
ccacttgccaaggttatcaatgacaggtttggtattgttgagggtttgatgaccactgtc
catgcaatcactgcaactcagaagaccgttgatggaccctcgagcaaggactggaggggt
ggaagggctgccagtttcaacatcatccctagcagcactggagctgcaaaggctgtcggc
aaggtgcttcctgctctcaatggaaagttgactggtatggctttccgtgttccaaccgtg
gatgtctctgtcgttgatttgactgtcaggcttgagaagccagcatcctatgatcagatt
aaggcagctatcaaggaggagtctgaggggaaactcaagggtattctgggttacgttgag
gaggaccttgtttccacagacttccagggtgacaacaggtcaagcatctttgatgcaaag
gccggtattgctctcaatgacaactttgttaagcttgtgtcttggtatgacaacgaatgg
ggatacagctctcgcgttgttgacctgatccgtcacatgtacaacacccagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341782
Entry
4341782           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4341782
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4341782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341782
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4341782
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     4341782
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4341782
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4341782
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C DapB_N DUF5559
Other DBs
NCBI-GeneID: 4341782
NCBI-ProteinID: XP_015641029
UniProt: A0A0P0X033 Q655W2
LinkDB
Position
6:complement(27601121..27605376)
AA seq 415 aa
MASLAVPLRASATPAIAGTGSGGGSRAADPVKVSCVRSKVTCGFPSVGASSSLASSVEPV
RATATQAPLATHQSSSTEKTKVGINGFGRIGRLVLRIATNRDDIEVVAVNDPFIDAKYMA
YMFKYDSTHGPFKGTIKVVDESTLEINGKKISVTSKRDPSDIPWGNFGAEYVVESSGVFT
TTEKASAHLKGGARKVVISAPSADAPMFVVGVNEKNYNPSMNVVSNASCTTNCLAPLAKI
VHEEFGIAEGLMTTVHATTATQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPA
LNGKLTGMAFRVPTPNVSVVDLTCRLEKSASYEDVKAAIKEASEGSLKGILGYTDEDVVS
NDFIGDTRSSIFDAKAGIGLSSSFMKLVSWYDNEWGYSNRVLDLIGHMALVNAKP
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcgtcgctcgccgtccccctccgcgcttccgccaccccggccatcgccggcaccggc
agcggcggcggatcacgcgccgccgaccccgtcaaggtgtcgtgcgttaggagcaaggtt
acctgcggttttccttccgttggggcttcgtcttcacttgctagcagcgttgagccggtg
agagcaactgctacacaagcaccccttgccacccatcaatcttctagcacggagaagaca
aaggttggcatcaatggatttggacggattgggaggttggttctacgaattgcaactaat
agagatgacattgaagttgtggctgttaatgatccttttatcgatgctaagtacatggct
tatatgttcaagtatgattcgacacatggtccatttaaaggcaccataaaggttgtggat
gagtcaaccttggagattaatgggaagaaaatttcagttacaagcaaaagagatccctca
gatattccttggggaaactttggagctgaatatgttgttgaatcatctggtgtttttaca
acaactgagaaagcatcagcacacttaaagggtggtgcaaggaaagtagtgatatctgct
ccatccgcagatgctcctatgtttgtagtcggagtaaatgagaagaattacaaccccagc
atgaatgttgtctctaatgcaagttgtactaccaactgtcttgcgccccttgccaagatt
gtccacgaggaatttggcatagctgagggcctcatgacaactgtccatgctacaacagcc
acccaaaagactgtcgacggtccttcaatgaaagattggaggggaggacggggtgctagt
cagaacatcatccctagttctactggcgcagcaaaggctgttggaaaggtccttccagca
ttaaacgggaaactcactggtatggccttccgagttcctacacctaacgtctctgtagtt
gacttgacatgccgtcttgagaaaagtgcttcttatgaggatgtgaaagcagctatcaag
gaagcctcagaaggttctttgaaaggtattttaggctacacagatgaggacgtcgtttcg
aatgatttcattggtgacaccaggtctagcatatttgatgccaaggctggaattggctta
agttcttctttcatgaagctcgtctcttggtacgacaacgagtggggctacagcaaccgg
gtcttggatttgatcgggcacatggctctcgtcaacgctaagccctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344564
Entry
4344564           CDS       T01015                                 
Name
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase (phosphorylating) [EC:1.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00002  Glycolysis, core module involving three-carbon compounds
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4344564
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4344564
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4344564
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4344564
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     4344564
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4344564
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4344564
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4344564
NCBI-ProteinID: XP_015650130
UniProt: Q0J8A4 I3QD45
Structure
LinkDB
Position
8:1525297..1529060
AA seq 337 aa
MGKIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHSD
IKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGGAKK
VVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLMTTV
HAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTV
DVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAK
AGIALNDNFVKLVAWYDNEWGYSNRVIDLIRHMAKTQ
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgggcaagattaagatcggaatcaacggtttcggaaggatcgggaggctcgtggccagg
gtggccctccagagcgaggatgtcgagctcgtcgccgtcaacgaccccttcatcaccacc
gactacatgacctacatgttcaagtacgataccgtgcacggccaatggaagcacagcgac
atcaagatcaaggactccaagactctgctcttgggcgagaagccggtcaccgttttcggc
atcaggaaccctgacgagattccgtgggctgaggctggtgctgagtatgtcgtggagtcc
accggtgtcttcactgacaaggagaaggctgctgctcacttgaagggtggtgccaagaag
gttgtcatctctgccccgagcaaagatgctccgatgtttgtctgcggtgtcaacgaggac
aagtacacttcagatattgatattgtctcaaatgctagctgcaccacaaactgccttgct
cctcttgccaaggtcattcatgacaactttggtattatcgagggtctgatgacaactgtt
catgccatcactgccacccaaaagaccgttgatggaccgtccagcaaggactggaggggt
ggcagggcggccagttttaacatcattcccagcagcactggtgctgccaaagctgttggc
aaggttcttcctgatttgaatggcaagcttacgggaatgtccttccgtgttcccactgtc
gatgtctcagttgttgatctcacagttagaatcgagaaggctgcctcatatgatgctatc
aagagtgctatcaagtctgcatcagagggaaagctcaagggaatcataggatatgttgag
gaagacctggtttctactgactttgttggtgacagcaggtcgagcatcttcgacgccaag
gctggaattgctcttaacgataactttgtcaagcttgtcgcctggtacgacaacgagtgg
ggttacagcaaccgtgtcatcgacctgatccgccacatggccaagacccagtag

DBGET integrated database retrieval system