KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328455
Entry
4328455           CDS       T01015                                 
Name
(RefSeq) choline-phosphate cytidylyltransferase 1
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4328455
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4328455
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     4328455
SSDB
Motif
Pfam: CTP_transf_like GST_C_3 DUF5932
Other DBs
NCBI-GeneID: 4328455
NCBI-ProteinID: XP_015626717
UniProt: Q6H513 Q0E3I4
LinkDB
Position
2:4024685..4028687
AA seq 315 aa
MADHAAAEAAPQSSQEEEEDWKEAEGGDGDVEVADRGGGGGAANGGIPEGRPIRVYADGI
YDLFHFGHAKSLEQAKRLFPNTYLLVGCCNDELTHKYKGRTVMTEDERYESLRHCKWVDE
VIPDAPWVVTEEFLNKHNIDFVAHDSLPYADASGAGNDVYEFVKKLGKFKETQRTDGIST
SDIIMRIVKDYNEYVMRNLARGYTRKDLGVSYVKEKRLRVNMGLKNLRDKVKQHQEKVGE
KWNTMAKLQEEWVENADRWVAGFLEKFEEGCHSMGTAIKERIQERLKAQSRDFSLLQYDG
EDVDEDEDDDEYVRE
NT seq 948 nt   +upstreamnt  +downstreamnt
atggccgaccacgctgcggcggaggcggcgccgcagtcgtcgcaggaggaggaggaggac
tggaaggaggccgaggggggagacggggacgtcgaggtggcggacaggggcggcggaggc
ggcgccgccaatgggggaatcccggaggggaggccgatccgggtctacgcggacggaatc
tacgatctcttccacttcggccacgccaagtcgctcgagcaggccaagaggctgtttcct
aacacatatctccttgtcggatgctgcaatgatgagttgacacataagtacaaagggaga
actgttatgacagaggatgagcgatatgaatcacttcgtcactgcaagtgggtggatgaa
gtcattcctgatgctccatgggtggtaacggaagaattcttgaataaacataacattgat
tttgttgcacatgattctctgccgtatgctgatgctagtggagctggtaacgatgtctat
gaatttgtcaaaaaacttggtaaatttaaggaaacccagcgcacagatgggatatcgacg
tcagatattataatgcggattgttaaggattataatgagtatgttatgcggaacctggcc
agggggtacaccagaaaggatcttggtgtcagttacgttaaggaaaaaagactgagagtt
aacatgggattaaaaaacctgcgtgacaaagtgaagcagcaccaagaaaaagtaggggag
aagtggaatacaatggcgaaactccaggaagagtgggtggaaaatgcagatcgatgggtt
gctggttttctggagaagtttgaagaaggctgccactcaatgggaactgccatcaaagag
cggatccaagagaggctcaaggcgcaatccagggatttcagccttctacagtatgatggc
gaggatgttgacgaggatgaggacgacgacgaatatgtcagagaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4344725
Entry
4344725           CDS       T01015                                 
Name
(RefSeq) choline-phosphate cytidylyltransferase 2
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4344725
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4344725
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     4344725
SSDB
Motif
Pfam: CTP_transf_like DUF5639
Other DBs
NCBI-GeneID: 4344725
NCBI-ProteinID: XP_015649450
UniProt: A0A0P0XCJ0 Q7EYE4
LinkDB
Position
8:complement(3619441..3621612)
AA seq 281 aa
MKPLKDADAQEKAAPPPTEWYDPLSSPGRPVRVYADGIYDLFHFGHARALEQAKKSFPNT
YLLVGCCSDEITNLYKGKTVMTEDERYESLRHCKWVDEVIPDAPWVINQEFLDKHRIDYV
AHDALPYADTSGAANDVYEFVKAVGKFKETKRTEGVSTSDIIMRILKDYNQYIMRNLTRG
YSRKDLGVSYVKEKQLRVNMGISKLREKVKEHQEKFHSAAKIAGSNPVEWMENADRWIVG
FLEKFEEGCHMMETAIKDRIQEGLKRQSRSDPNLSGEDSDS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaagccactgaaggacgcggacgcgcaggagaaggcggcgccgccgccgacggagtgg
tacgacccgctgtcgtcgccggggcggccggtcagggtgtacgccgatggcatctacgac
ctcttccacttcggccatgcccgcgccctcgagcaggccaagaaatcattccccaacaca
tatttgctcgtgggctgctgcagcgacgagatcaccaacctttacaaaggcaagaccgtc
atgactgaagacgagcgctacgaatcgcttcgccattgcaagtgggtggatgaggtgata
ccagatgctccatgggttatcaatcaggagttcctagacaagcaccgcatcgactacgtc
gctcatgatgctcttccgtatgcggacaccagtggagctgccaatgatgtctatgaattt
gtgaaggccgttgggaagttcaaggagacgaagcgcaccgagggcgtctcgacgtctgac
atcatcatgaggatcttgaaggactacaaccagtacatcatgcgaaatctgacccgggga
tactcccgcaaagacctcggtgtgagctatgtcaaggagaagcaacttagagtaaacatg
gggatcagcaagctaagggagaaggtgaaggagcatcaagagaagtttcacagcgcggca
aagatagctggaagcaatcctgtggagtggatggagaatgccgaccgttggatcgttggg
tttcttgaaaagtttgaggaaggttgccacatgatggaaaccgcgattaaagatcggatt
caggaggggctgaagaggcaaagcaggtcggaccccaacctttctggggaggattccgac
tcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349510
Entry
4349510           CDS       T01015                                 
Name
(RefSeq) choline-phosphate cytidylyltransferase 2
  KO
K00968  choline-phosphate cytidylyltransferase [EC:2.7.7.15]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00440  Phosphonate and phosphinate metabolism
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4349510
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    4349510
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.15  choline-phosphate cytidylyltransferase
     4349510
SSDB
Motif
Pfam: CTP_transf_like DUF5639 DUF5932
Other DBs
NCBI-GeneID: 4349510
NCBI-ProteinID: XP_015614240
UniProt: A3C7N3 Q9XFE5
LinkDB
Position
10:complement(23079468..23082292)
AA seq 289 aa
MARVSHSRKRTRAPSNSNSKPTSQTQPPPPELTDRPVRVYADGIFDLFHFGHARALEQAK
LLFPNTYLLVGCCNDELTNRYKGKTVMTQDERYESLRHCKWVDEVIPDAPWVLTQEFIDK
HQIDYVAHDALPYADTSGAANDVYEFVKKIGKFKETKRTDGVSTSDLIMRILKDYNQYVM
RNLARGYTRKDLGVSYVKEKQLQVNMKINKLRETVKAHQEKLQTVAKTAGINHEEWLANA
DRWVAGFLEKFEEHCHNMETAIKGRIQEKLRRQTSRGIIGGLMQQPVAA
NT seq 870 nt   +upstreamnt  +downstreamnt
atggcgcgcgtttcgcattccagaaagcggactagggctccctccaactccaactccaag
cccacttcacaaacccaaccgccgccgccggagctcaccgaccgccctgtccgcgtctac
gccgacggcatcttcgatctcttccacttcggccatgcccgcgccctcgagcaggccaag
ttgctgttccccaacacgtacctgctagtgggctgctgcaacgacgagctcaccaaccgc
tacaagggcaagaccgtcatgacccaggatgagcgatacgagtcccttcgccactgcaaa
tgggttgatgaggtcattcctgatgctccatgggtcctcacgcaagagttcattgacaaa
catcagattgactatgttgctcatgatgcactgccttatgccgatactagtggagctgct
aatgatgtctatgaatttgttaaaaagattggcaaattcaaggaaacgaaacggacagac
ggtgtatccacatcagacctcataatgaggatattgaaggactacaatcagtatgtcatg
aggaatttagcacgtggatacacaaggaaagatttaggcgtaagctatgttaaggaaaag
caactccaggtcaacatgaagataaataaactgcgagagactgtaaaggcgcatcaagaa
aagttgcaaacggtggcgaagacagctggaataaatcatgaagaatggttggccaatgca
gatcgctgggttgctggtttcttggagaagtttgaggaacactgccacaacatggaaact
gccatcaaggggcgtatccaggagaaattgaggaggcaaacaagcagagggataattggg
ggtctaatgcagcaaccggtggcagcgtaa

DBGET integrated database retrieval system