KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328472
Entry
4328472           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L27a-3
  KO
K02900  large subunit ribosomal protein L27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328472
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4328472
SSDB
Motif
Pfam: Ribosomal_L27A DUF5026
Other DBs
NCBI-GeneID: 4328472
NCBI-ProteinID: XP_015627196
UniProt: A0A0P0VFI3 Q6EUQ7
LinkDB
Position
2:4134895..4135629
AA seq 144 aa
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
FHRLSNRFHCPAVNVERLWSMVPAEAGAGAGKAPVIDVTQFGYTKVLGKGMLPPERPIVV
KAKLISKVAEKKIKAAGGAVLLTA
NT seq 435 nt   +upstreamnt  +downstreamnt
atgacgacgaggttcaagaagaaccggaagaagcgcgggcacgtgtcggccgggcacggg
cggatcgggaagcaccggaagcacccgggagggcgcgggaacgccggcgggatgcaccac
caccgcatcctgttcgacaagtaccacccgggctacttcggcaaggtcgggatgcgctac
ttccacaggctcagcaacaggttccactgccccgccgtcaacgtcgagcgcctctggtcc
atggtgcccgccgaggccggcgccggcgccggcaaggcccccgtcatcgacgtcacgcag
ttcggctacaccaaggtgctcggcaaggggatgctccccccagagaggcccatcgtcgtc
aaggccaagctcatctccaaggtcgccgagaagaagatcaaggccgccggcggcgccgtc
ctcctcaccgcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333083
Entry
4333083           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L27a-3
  KO
K02900  large subunit ribosomal protein L27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4333083
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4333083
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4333083
SSDB
Motif
Pfam: Ribosomal_L27A DUF5026
Other DBs
NCBI-GeneID: 4333083
NCBI-ProteinID: XP_015632850
UniProt: Q0DR87 Q84MQ4
LinkDB
Position
3:16787170..16787912
AA seq 146 aa
MTTRFKKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
FHKLSNRFHCPAVNVERLWSMVPTDKAAEAGAGKAPVIDVTQFGYTKVLGKGMLPPQRPI
VVKAKLISKVAEKKIKAAGGAVLLTA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgacaacgcgcttcaagaagaaccggaagaagcgcggccacgtgtcggccgggcacggg
cgcatcgggaagcaccgcaagcaccccggaggccgcggtaacgccggagggatgcaccac
caccggatcctgttcgacaagtaccacccgggctacttcggcaaggtcggcatgcgctac
ttccacaagctcagcaacaggttccactgccccgccgtcaacgtcgagcgcctctggtcc
atggtgcccaccgacaaggccgccgaggccggcgccggcaaggcccccgtcatcgacgtc
acccagttcggctacaccaaggtgctcggcaaggggatgcttcccccgcagaggcccatc
gtcgtcaaggccaagctcatctccaaggtcgccgagaagaagatcaaggccgccggcggc
gccgtcctcctcaccgcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343884
Entry
4343884           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L27a-2
  KO
K02900  large subunit ribosomal protein L27Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4343884
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4343884
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4343884
SSDB
Motif
Pfam: Ribosomal_L27A DUF5026
Other DBs
NCBI-GeneID: 4343884
NCBI-ProteinID: XP_015644922
UniProt: A0A0P0X901 Q8GSE9
LinkDB
Position
7:complement(25236682..25237488)
AA seq 146 aa
MTTSLRKNRKKRGHVSAGHGRIGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRY
FHRLRNKFYSPAVNVERLWSMVPAEQAAEAAGAGKAPLLDVTQFGYFKVLGKGLLPEKPI
VVKAKLISKVAEKKIKAAGGAVVLTA
NT seq 441 nt   +upstreamnt  +downstreamnt
atgacgacgagcctgaggaagaaccgcaagaagcgcggccacgtgtccgccggccacggc
cgcatcgggaagcaccggaagcacccgggaggccggggcaacgccggaggcatgcaccac
caccgcatcctcttcgacaagtaccacccgggctacttcggcaaggtcggcatgcgctac
ttccacaggctccgcaacaagttctactccccggcggtgaacgtggagcggctctggtcg
atggtgcccgccgagcaggcggcggaggccgccggcgccggcaaggcgcccctgctggac
gtgacgcagttcggctacttcaaggtgctcgggaagggtctgctgccggagaagcccatc
gtcgtcaaggccaagctcatctccaaggtcgccgagaagaagatcaaggccgccggcggc
gccgtcgtgctcaccgcctag

DBGET integrated database retrieval system