KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328485
Entry
4328485           CDS       T01015                                 
Name
(RefSeq) probable 4-coumarate--CoA ligase 3
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4328485
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4328485
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4328485
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4328485
NCBI-ProteinID: XP_015625716
UniProt: Q6ETN3
LinkDB
Position
2:4280489..4285918
AA seq 554 aa
MGSVAAEEVVVFRSKLPDIEIDNSMTLQEYCFARMAEVGARPCLIDGQTGESYTYAEVES
ASRRAAAGLRRMGVGKGDVVMSLLRNCPEFAFSFLGAARLGAATTTANPFYTPHEVHRQA
EAAGARVIVTEACAVEKVREFAAERGVPVVTVDGAFDGCVEFREVLAAEELDADADVHPD
DVVALPYSSGTTGLPKGVMLTHRSLITSVAQQVDGENPNLYFSKDDVILCLLPLFHIYSL
NSVLLAGLRAGSTIVIMRKFDLGALVDLVRKHNITIAPFVPPIVVEIAKSPRVTAEDLAS
IRMVMSGAAPMGKDLQDAFMAKIPNAVLGQGYGMTEAGPVLAMCLAFAKEPFKVKSGSCG
TVVRNAELKIVDPDTGTSLGRNQSGEICIRGEQIMKGYLNDPEATKNTIDEDGWLHTGDI
GFVDDDDEIFIVDRLKEIIKYKGFQVPPAELEALLITHPEIKDAAVVSMKDDLAGEVPVA
FIVRTEGSEITEDEIKKFVAKEVVFYKRINKVFFTDSIPKNPSGKILRKDLRARLAAGIP
DAVAAAAADAPKSS
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggggtcggtggcggcggaggaggtggtggtgttccggtcgaagctgccggacatcgag
atcgacaacagcatgacgctgcaggagtactgcttcgcgaggatggcggaggtcggggcg
cggccgtgcctgatcgacgggcagaccggggagtcgtacacgtacgcggaggtggagtcc
gcgtcgcggcgcgccgcggcggggctccggcggatgggggtgggcaagggcgacgtggtg
atgagcctcctccgcaactgccccgagttcgccttctccttcctcggcgcggccaggctg
ggcgccgccaccacgacggcgaacccgttctacacgccgcacgaggtccaccgccaggcg
gaggccgcgggcgccagggtgatcgtcaccgaggcgtgcgccgtcgagaaggtgcgggag
ttcgccgcggagaggggcgtccccgtggtcaccgtggacggcgcgttcgacggctgcgtg
gagttccgcgaggtgctcgccgcggaggagctcgacgccgacgccgacgtccaccccgac
gacgtcgtcgccctcccctactcctccggcaccaccggcctccccaagggcgtcatgctc
acccaccgcagcctcatcaccagcgtcgcccagcaggtggatggagagaaccctaacctg
tacttcagcaaggatgatgttatactatgcctgctgccactgttccacatctactcgctc
aactccgtgctgctggctggcctgcgtgccgggtcgaccatcgtgatcatgcggaagttt
gatcttggcgcgctcgtcgaccttgtgcgcaagcacaacatcaccatcgcccccttcgtg
ccccccatcgtggtggagatcgccaagagcccccgcgtcaccgcggaggacctcgcctcc
atccgcatggtcatgtccggtgccgcgcccatggggaaggaccttcaggatgcattcatg
gccaagatccccaatgccgtcctcggacagggttacggtatgactgaggctgggccagtg
ctggcaatgtgcctggcgtttgccaaggagcccttcaaggttaagtccgggtcgtgcggt
acagtggtgcgcaacgcggagctgaagatcgtcgaccccgacaccggcacctccctcggc
cggaaccagtccggcgagatctgcatccgcggagaacagatcatgaaaggctatctgaat
gatcctgaggcgaccaagaacaccatcgacgaggacgggtggctgcacaccggagacatc
ggcttcgtcgacgacgacgacgagatcttcatcgtggacaggctcaaggagatcatcaag
tacaaggggttccaggtgccaccggccgagctggaggcgctgctcatcactcacccggag
atcaaggacgccgccgtcgtctcgatgaaggatgatcttgccggtgaagtgccagtcgcc
ttcattgtccggacagaaggctcagaaatcaccgaggatgagatcaagaaattcgttgca
aaagaggtggtgttctacaagaggatcaacaaggtgttcttcaccgattccatccccaag
aacccttccggcaagatcctcaggaaggacttgagagccaggctcgccgccggcatcccc
gacgccgtcgccgccgccgccgccgatgcgcccaaaagcagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330407
Entry
4330407           CDS       T01015                                 
Name
(RefSeq) probable 4-coumarate--CoA ligase 2
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4330407
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4330407
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4330407
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4330407
NCBI-ProteinID: XP_015624111
UniProt: Q42982
LinkDB
Position
2:complement(28677217..28680912)
AA seq 569 aa
MITVAAPEAQPQVAAAVDEAPPEAVTVFRSKLPDIDIPSHLPLHEYCFARAAELPDAPCL
IAAATGRTYTFAETRLLCRRAAAALHRLGVGHGDRVMVLLQNCVEFAVAFFAASFLGAVT
TAANPFCTPQEIHKQFKASGVKLILTQSVYVDKLRQHEAFPRIDACTVGDDTLTVITIDD
DEATPEGCLPFWDLIADADEGSVPEVAISPDDPVALPFSSGTTGLPKGVVLTHRSVVSGV
AQQVDGENPNLHMGAGDVALCVLPLFHIFSLNSVLLCAVRAGAAVALMPRFEMGAMLGAI
ERWRVTVAAVVPPLVLALAKNPFVERHDLSSIRIVLSGAAPLGKELEDALRARLPQAIFG
QGYGMTEAGPVLSMCPAFAKEPTPAKSGSCGTVVRNAELKVVDPDTGFSLGRNLPGEICI
RGPQIMKGYLNDPEATAATIDVEGWLHTGDIGYVDDDDEVFIVDRVKELIKFKGFQVPPA
ELESLLIAHPSIADAAVVPQKDDVAGEVPVAFVVRAADSDITEESIKEFISKQVVFYKRL
HKVHFIHAIPKSASGKILRRELRAKLAAC
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgatcacggtggcggcaccggaggcgcagccgcaggtggcggcggcggtcgatgaggcg
ccgccggaggcggtgacggtgttccggtccaagcttccggacatcgacatccccagccac
ctgcccctgcacgagtactgcttcgccagggcggccgagctccccgacgcgccgtgcctc
atcgcggcggccacggggaggacgtacacgttcgccgagacgcgcctgctgtgccgcagg
gccgccgcggcgctgcaccggctgggcgtcggccacggcgaccgcgtcatggtgctgctc
cagaactgcgtggagttcgccgtggcgttcttcgccgcgtcgttcctcggcgcggtcacc
accgccgccaacccgttctgcacgccgcaggagatccacaagcagttcaaggcctccggc
gtgaagctcatcctcacccagtccgtctacgtcgacaagctccggcagcacgaggcgttc
ccaaggatcgacgcctgcaccgtcggcgacgacacgctcaccgtgatcaccatcgacgac
gacgaggcgacgccggaaggctgcctgccgttctgggacctgatcgcggacgccgacgag
gggtccgtcccggaggtggccatctcgccggacgaccccgtggcgctgccgttctcgtcg
ggcacgacgggcttgcccaagggcgtggtgctgacgcacaggagcgtcgtgtcgggcgtg
gcgcagcaggtggacggcgagaacccgaacctgcacatgggtgccggcgacgtggcgctg
tgcgtgctgccgctgttccacatcttctcgctcaactccgtgctgctgtgcgcggtgcgc
gccggcgcggcggtggcgctgatgcccaggttcgagatgggcgccatgctgggggccatc
gagcggtggcgcgtgacggtggcggccgtcgtgccgccgctcgtgctcgcgctcgccaag
aacccgttcgtggagcgccacgacctcagctccatccgcatcgtgctctccggcgccgcc
ccgctcggcaaggagctcgaggacgccctccgcgcccgcctgcctcaggccatcttcgga
cagggatacgggatgacggaggcggggccggtgctgtcgatgtgcccggcgttcgccaag
gagccgacgccggcgaagtccgggtcgtgcgggacggtggtgcggaacgcggagctcaag
gtggtcgacccggacacgggcttctccctcggccgcaacctccccggcgagatctgcatc
cgcggcccacagatcatgaaaggttacctgaacgatcccgaggcgaccgccgcgacgatc
gacgtcgaggggtggctgcacaccggcgacatcggctacgtcgacgacgacgacgaggtc
ttcatcgtcgaccgtgtcaaggagctcatcaaattcaaggggttccaggtgccgccggcc
gagctggagtcgctgctcatcgctcacccgtccatcgctgacgccgccgtcgtcccgcaa
aaggatgacgtcgccggcgaggtcccggtcgcgttcgtggtccgcgccgccgactccgac
atcacggaggagtccatcaaggaattcatatccaagcaggtggtgttctacaagaggcta
cacaaggtgcacttcatccatgcgatccccaagtcggcgtctgggaagatactgaggaga
gagctcagagccaagctcgcggcgtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331650
Entry
4331650           CDS       T01015                                 
Name
(RefSeq) 4-coumarate--CoA ligase-like 1
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4331650
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4331650
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4331650
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4331650
NCBI-ProteinID: XP_015629881
UniProt: Q0DV32
LinkDB
Position
3:complement(2883038..2887917)
AA seq 552 aa
MASASVPAAGYGADGVYRSLRPPAPVASDPGLSLTDLLLRRADACPSAVALADAAAGGRA
LTFAELRSAVLSTAVALSSRAGVRPGDAVLLLAPNCVLYPVCFFAVTALGAVGTTVNPDY
TPREIAKQVSDARAKLVITISALVPKIAGLRLPVILLDDDANAAAASLPPDATVTLYTNL
VAGVKEADYRRPPIKQSDTAALLYSSGTTGDSKGVILTHRNFIAAARMVTSDQDERREGP
NVFLCFLPMFHIFGLSVITYAQLHRGNAIIAMSRFDINSLMEAVQRHRVTHLFCVPPVII
ALAKHGKAGKYDLSSLKFIGSGAAPLGKDVMEVVAKKFPDSEIVQGYGMTETCGIISLEY
PEKGQAREFGSTGTLVSGVEAKIVDIKTLKHLPPNQVGEICVRGPNVMQGYFNNVQATEF
TIKQGWLHTGDLGYFDGGGQLFVVDRLKELIKYKGFQIAPAELEGLLLSHPEILDAVVIP
FPDAKAGEVPIAYVVRSPDSSLTEVDVQKFIEKQVAYYKRLKRVTFVGSVPKSASGKILR
RQLIAQVRSSKL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggcgagcgcgtcggtgccggccgccggctacggcgcggacggcgtgtaccgctcgctg
cgcccgcccgcgcccgtcgcgtccgacccgggcctctccctcaccgacctcctcctccgc
cgcgccgacgcctgcccctccgcggtcgcgctcgccgacgcggccgccggcggccgcgcc
ctcaccttcgcggagctgaggtcggccgtcctctccaccgccgtcgcgctctcctcccgc
gcgggcgtgcgacccggcgacgccgtgctcctcctcgcgcccaactgcgtgctctacccg
gtctgcttcttcgccgtcaccgccctcggcgccgtcggcaccaccgtcaacccggactac
accccgcgggagatcgccaagcaggtctccgacgcgcgcgccaagctcgtcatcaccatc
tccgccctggtgcccaagattgcggggctccgcctccccgtcatcctcctcgacgacgac
gcgaacgccgcggccgcctccttgcctccggacgccaccgtcacgctctacaccaacctc
gtcgccggcgtgaaggaggcggattaccgccgcccaccaatcaagcagagcgacacggcg
gctctcctctactcgtcgggcacgacgggggatagcaagggcgtcatcctgacgcaccgc
aacttcatcgccgcggcgaggatggtgacctccgaccaagacgagcgccgggaggggccc
aacgtgttcctctgcttcctccccatgttccacatcttcggcctgtccgtcatcacgtac
gcgcagctgcatcgcgggaacgccatcatcgccatgtcgcggttcgacatcaactccctg
atggaggccgtgcagaggcaccgcgtcacgcacctgttctgcgtgccgccggtcattatc
gcgctcgccaagcacgggaaggccggtaagtacgatctcagctctctcaagttcatcggc
tccggcgccgcgccgctcggcaaggatgtgatggaggtcgtggccaagaaattcccggac
agtgagattgttcagggttatggtatgactgagacttgtggaatcatatcgctcgagtac
ccagaaaaaggacaggctcgtgaatttgggtcaactggcacgcttgtctcaggagttgag
gcaaagattgtcgacataaagacattaaaacatctaccgcccaatcaagtaggagaaatt
tgtgttcgagggccaaatgtaatgcaagggtatttcaacaatgtgcaagctactgaattt
acaatcaagcaagggtggttgcacactggtgatcttggatacttcgacggaggaggccag
ctttttgttgttgatagacttaaagaactgattaagtacaaaggtttccagattgcacct
gccgagcttgaagggttacttctatctcatccagagattctagatgctgttgttatcccg
tttcctgatgctaaagctggggaggttcccattgcctatgttgttcggtcacctgacagt
tcattgacagaagttgatgtccaaaaatttattgaaaaacaggtggcgtactacaaaaga
ttgaagagagttacctttgtgggcagcgtgcccaaatcagcttcaggaaagattctgaga
aggcagcttatcgcccaagtgagatcatccaagttgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341718
Entry
4341718           CDS       T01015                                 
Name
(RefSeq) probable 4-coumarate--CoA ligase 4
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4341718
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4341718
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4341718
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4341718
NCBI-ProteinID: XP_015643415
UniProt: Q67W82
LinkDB
Position
6:complement(26943150..26949884)
AA seq 559 aa
MGSMAAAAEAAQEEETVVFRSKLPDIEIPSHLTLQAYCFEKLPEVAARPCLIDGQTGAVY
SYGEVEELSRRAAAGLRRLGVGKGDVVMSLLRNCPEFAFTFLGAARLGAATTTANPFYTP
HEIHRQASAAGARVIVTEACAVEKVRGFAADRGIPVVAVDGDFDGCVGFGEAMLDASIEP
LDADEEVHPDDVVALPYSSGTTGLPKGVMLTHRSLVTSVAQQVDGENPNLYFRREDVVLC
LLPLFHIYSLNSVLLAGLRAGSAIVIMRKFDLGALVDLTRRHGVTVAPFVPPIVVEIAKS
PRVTADDLASIRMVMSGAAPMGKDLQDAFMAKIPNAVLGQGYGMTEAGPVLAMCLAFAKE
PFEVKSGSCGTVVRNAELKIVDPDTGATLGRNQSGEICIRGEQIMKGYLNDPESTKNTID
KGGWLHTGDIGYVDDDDEIFIVDRLKEIIKYKGFQVPPAELEALLITHPDIKDAAVVPMI
DEIAGEVPVAFIVRIEGSAISENEIKQFVAKEVVFYKRLNKVFFADSIPKSPSGKILRKD
LRAKLAAGIPTNDNTQLKS
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggggtccatggcggcggcggcggaggcggcgcaggaggaggagacggtggtgttccgg
tccaagctccccgacatcgagatccccagccacctcaccctgcaggcctactgcttcgag
aagcttccggaggtggccgcccgcccctgcctcatcgacgggcagaccggggcggtgtac
agctacggcgaggtggaggagctctcccggcgcgcggcggcggggctgcggcggctcggg
gtggggaagggcgacgtggtgatgagcctcctccgcaactgccccgagttcgccttcacc
ttcctcggcgccgccaggctgggcgcggccaccaccaccgccaacccgttctacaccccg
cacgagatccaccgccaggcgtcggcggcgggcgccagggtgatcgtgaccgaggcgtgc
gcggtggagaaggtgcgcgggttcgccgccgaccgcggcatccccgtggtcgccgtcgac
ggggacttcgacggctgcgtcgggttcggggaggcgatgctggacgcgtccatcgagccg
ctcgacgccgacgaggaggtccaccccgacgacgtcgtcgccctcccttactcctccggc
accaccggcttgcccaagggcgtcatgctcacccaccgcagcctcgtcaccagcgtcgcg
cagcaggtggacggggagaacccgaacctgtacttcaggagggaggacgtggtgctgtgc
ttgctgccgctgttccacatctactcgctcaactccgtgctgctggcggggctgcgagcc
gggtcggcgatcgtgatcatgcgcaagttcgacctgggcgcgctggtggacctgacgcgg
aggcacggcgtcaccgtcgcgccgttcgtgccgcccatcgtggtggagatcgccaagagc
ccccgcgtcaccgccgacgacctcgcctccatccgcatggttatgtccggcgccgccccc
atggggaaggacctccaggacgccttcatggccaagatccccaacgccgtcctgggacag
gggtatgggatgactgaggctggacctgtgctggccatgtgtctggccttcgcaaaggag
ccattcgaggtcaagtccggctcgtgcgggacagtcgtcagaaacgcggagctgaagatc
gttgaccctgacaccggcgccacccttggccggaaccagtccggggagatttgcatccgg
ggagaacaaatcatgaaaggttatctgaatgacccggagtccacgaagaacaccatcgac
aagggcggttggctgcacacaggagacattggttatgttgacgacgacgacgagattttc
attgttgaccggctcaaggaaataataaaatacaaggggttccaagtacctcctgcggaa
cttgaagctcttctcatcacacaccctgatatcaaggatgctgccgttgtaccgatgata
gacgaaattgcgggtgaagtgccggttgcattcattgtacggattgaaggatctgcaatc
agcgagaatgagatcaagcaatttgtggcaaaggaggttgttttctacaagaggctcaac
aaagttttcttcgcggattcaattccgaagagtccttctggcaagattctcaggaaggac
ctcagagcaaagcttgcagccggcatccctaccaatgataatacacagttgaaaagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345054
Entry
4345054           CDS       T01015                                 
Name
(RefSeq) probable 4-coumarate--CoA ligase 1
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4345054
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4345054
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4345054
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4345054
NCBI-ProteinID: XP_015650724
UniProt: P17814
LinkDB
Position
8:8874079..8878919
AA seq 564 aa
MGSMEQQQPESAAPATEASPEIIFRSKLQDIAITNTLPLHRYCFERLPEVAARPCLIDGA
TGGVLTYADVDRLSRRLAAALRRAPLGLRRGGVVMSLLRNSPEFVLSFFAASRVGAAVTT
ANPMSTPHEIESQLAAAGATVVITESMAADKLPSHSHGALTVVLIDERRDGCLHFWDDLM
SEDEASPLAGDEDDEKVFDPDDVVALPYSSGTTGLPKGVMLTHRSLSTSVAQQVDGENPN
IGLHAGDVILCALPMFHIYSLNTIMMCGLRVGAAIVVMRRFDLAAMMDLVERHRVTIAPL
VPPIVVAVAKSEAAAARDLSSVRMVLSGAAPMGKDIEDAFMAKLPGAVLGQGYGMTEAGP
VLSMCLAFAKEPFKVKSGACGTVVRNAELKIIDPDTGKSLGRNLPGEICIRGQQIMKGYL
NNPEATKNTIDAEGWLHTGDIGYVDDDDEIFIVDRLKEIIKYRGFQVAPAELEALLITHP
SIADAAVVGKQIEPEIGEIPVAFVAKTEGSELSEDDVKQFVAKEVIYYKKIREVFFVDKI
PKAPSGKILRKELRKQLQHLQQEA
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggggtccatggagcagcagcagccggagtcggcggcgccggcgacggaggcgtcgccg
gagatcatcttccggtcgaagctgcaagacatcgccatcaccaacaccctcccgctccac
cgctactgcttcgagcggctcccggaggtggcggcgcgcccatgcctcatcgacggagcc
accggcggcgtgctcacctacgccgacgtcgaccgcctgtcccgccgcctcgccgccgcg
ctccgccgcgcgccgctggggctccggcggggcggcgtcgtgatgagcctgctgcggaac
tcgccggagttcgtgctgtccttcttcgccgcgtcgcgcgtcggcgccgcggtgaccacg
gcgaacccaatgtccaccccgcacgagatcgagagccagctcgccgccgccggcgccacc
gtcgtcatcaccgagtccatggccgccgacaagctcccctcccactcccacggcgccctc
accgtcgtcctcatcgacgagcgccgcgacggctgcctccacttctgggacgacctcatg
tcggaggacgaagcgtcgccgctcgccggcgacgaggacgacgagaaggtgttcgacccg
gacgacgtggtggcgctgccgtactcgtcggggacgacgggtctccccaagggggtgatg
ctaacgcaccggagcctgagcacgagcgtggcgcagcaggtcgacggcgagaacccaaac
atcgggctccacgccggcgacgtgatcctgtgcgcgctgcccatgttccacatctactcg
ctcaacaccatcatgatgtgcggcctccgcgtcggcgccgccatcgtcgtcatgcgccgc
ttcgacctcgccgccatgatggacctcgtcgagcgccaccgcgtcaccatcgcgccgctc
gtgccgcccatcgtcgtggccgtggccaagagcgaggcggcggcggcgcgagacctctcg
tcggtgcggatggtgctctccggcgcggcgcccatgggcaaggacatcgaggacgcgttc
atggccaagctccccggcgccgtgctcggacaggggtatggaatgactgaggcagggcca
gtgctgtcaatgtgcctagcattcgccaaggagcccttcaaggtgaagtccggtgcgtgc
gggacggtggtgcgcaacgccgagctgaagatcatcgaccccgacaccgggaagtcgctt
ggccggaacctgcccggcgagatctgcatcagggggcaacagatcatgaaaggttacctg
aacaacccagaggccacgaagaacaccattgatgcagaagggtggctgcacaccggcgac
atcggctacgtcgacgacgacgacgagatcttcatcgtggataggctcaaggagatcatc
aaatacaggggcttccaggtagcccctgcagagctggaggcccttctcatcacccatcca
agcattgctgatgctgctgttgttgggaaacaaattgagcctgaaatcggagaaatacca
gtcgccttcgtggcgaaaaccgaagggagtgagctgagtgaagatgatgtcaaacaattc
gtagcaaaggaggtgatctactacaagaagatccgggaggtcttcttcgttgacaaaatc
cccaaggcgccgtcagggaagatcctgagaaaggaactgaggaagcagctgcaacatctt
caacaagaagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345717
Entry
4345717           CDS       T01015                                 
Name
(RefSeq) probable 4-coumarate--CoA ligase 5
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    4345717
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4345717
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     4345717
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 4345717
NCBI-ProteinID: XP_015650830
UniProt: Q6ZAC1
LinkDB
Position
8:complement(21873064..21875506)
AA seq 539 aa
MGSLPEQFVFRSRLPDIAIPDHLPLHDYVFERLADRRDRACLIDGATGETLSFGDVDALS
RRVAAGLSSIGVCHGSTVMLLLPNSVEFAVAFLASSRLGAVTTTANPLHTPPEIAKQVAA
SGATVVVTEPAFVAKVSGLAGVTVVATGGGAERCASFAGLAAADGSALPEVAIDVANDAV
ALPYSSGTTGLPKGVMLSHRGLVTSVAQLVDGENPNLHLREDDVVLCVLPMFHVYSLHSI
LLCGMRAGAAIVVMKRFDTVKMLQLVERHGVTIAPLVPPIVVEMAKSDALDRHDLSSIRM
VISGAAPMGKELQDIVHAKLPNAVLGQGYGMTEAGPVLSMCMAFAKEPTPVKSGACGTVV
RNAELKIVDPDTGLSLPRNQPGEICIRGKQIMKGYLNNPEATEKTIDKDGWLHTGDIGFV
DDDDEIFIVDRLKELIKYKGFQVAPAELEAMLIAHAAVADAAVVPMKDDSCGEIPVAFVV
ARDGSGITDDEIKQYVAKQVVFYKRLHKIFFVDAIPKAPSGKILRKDLRAKLAAGIPAC
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgggttcgttgccggagcagttcgtcttccgctcgaggctccccgacatcgccatcccg
gaccacctcccgctgcacgactacgtgttcgagcgcctcgccgaccgccgcgaccgggca
tgccttatcgatggcgccacgggggagacgctctcgttcggcgacgtcgacgcgctgtcg
cgccgcgtggcggctgggttgagctcgattggtgtttgccatggtagtaccgtgatgctg
ctgctgccgaactccgtcgagttcgcggtggcgttcctcgcgtcgtcacggctcggggcg
gtcaccaccacggccaacccgctgcacaccccgccggagatcgccaagcaggtggcggcg
tccggcgcgacggtggtggtcaccgagccggcgttcgtcgccaaggtgagcggcctcgcg
ggcgtgaccgtcgtcgccaccgggggcggcgccgagaggtgcgcgtcgttcgcgggcctc
gccgccgccgacggctcggcgctgccggaggtcgccatcgacgtcgccaacgacgccgtg
gcgctgccctactcgtcgggcacgacggggctccccaagggggtgatgctgtcgcaccgc
gggctggtgaccagcgtggcgcagctcgtcgacggcgagaacccgaacctccacctccgg
gaggacgacgtggtgctctgcgtgctccccatgttccacgtctactccctccactccatc
ctcctctgcgggatgcgcgccggcgccgccatcgtggtcatgaagcggttcgacaccgtc
aagatgctgcagctggtggagcgccacggcgtcaccatcgcgccgctcgtccctcccatc
gtcgtcgagatggccaagagcgacgccctcgaccgccacgacctctcctccatccgcatg
gtcatctccggcgccgcccccatgggcaaggagcttcaggacatcgtccacgccaagctc
cccaacgccgtcctcggacaggggtacgggatgacggaggcagggccggtgctatcaatg
tgcatggcgttcgcgaaggagccgacgccggtgaagtccggcgcgtgcggcacggtggtg
cggaacgccgagctgaagatcgtcgacccggacaccggcttgtcactcccgcgcaaccag
ccgggggagatttgcatcaggggaaaacaaatcatgaaaggatacctgaacaacccggag
gcgaccgagaagacgatcgacaaggacgggtggctgcacactggcgacatcggcttcgtc
gacgacgacgacgagatcttcatcgtggaccggctcaaggagctcatcaagtacaagggc
ttccaggtcgcccccgccgagctcgaggccatgctcatcgcccacgccgccgtcgccgac
gccgccgtcgtcccaatgaaggacgattcctgcggcgagatcccagtggcgttcgtcgtc
gcacgcgacggctcggggatcaccgacgacgagatcaagcagtacgtcgcaaagcaggtg
gtgttctacaagaggctgcacaagatcttcttcgtggacgcaatcccgaaggcgccgtcg
ggaaagattttgaggaaggatctgagagcaaagttggctgctggaattccggcgtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267647
Entry
9267647           CDS       T01015                                 
Name
(RefSeq) LOW QUALITY PROTEIN: 4-coumarate--CoA ligase-like 9
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    9267647
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9267647
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     9267647
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF3043
Other DBs
NCBI-GeneID: 9267647
NCBI-ProteinID: XP_015635191
LinkDB
Position
4:complement(14072646..14074937)
AA seq 622 aa
MTQPNLTYTPLVMVTHKNRVILATTTTTTMSSPSSRHPSSPXLSTNARAPATPTTTQEAC
AADRHRDMGDAAVPAMVVEEEEQEHVFRSRFPPVAVPDGVTVPEFVLDGAEAYADRVALV
EAAAGGRSYTYGEVARDTARFARALRSVGVRKGHVVVVALPNLAVYPVVSLGIMSAGAVF
SGVNPRALAAEIKKQVEDSEAKLVVANEVAFDKVKDAGVPVIGVGDRERMPGAISWDGLL
AAADRTGAGVVPVDAAQQSDLCALPYSSGTTGVSKGVMLSHRNLVSNLCSSMFAVAPETA
GQVVTLGLMPFFHIYGITGICCATLRHKGTVVVMDRFDLRTFLRALVDHRVMFAPLVPPV
MLAMVKSPVADEFDLSDLALKSVMTAAAPLAPDLLAAFQRKFPGVQVEEAYGLTEHSCIT
LTHAAGDGHGHVAKKSSVGFILPNLEVKFVDPDTGRSLPANTPGELCVRSQSVMQGYYKR
KEETERTVDGKGWLHTGDVGYIDGDGDVFIVDRIKELIKYKGFQVAPAELEAVLLSHPSV
EDAAVFGVPDEEAGEVPVACVVRRHGAEEGEEEIVAYVAERVASYKRVRVLHIVDAIPKS
VSGKILRRQLRDEFIKRMKPSA
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgacccaaccaaacctcacctacaccccactagtcatggtaacacacaagaaccgtgtc
atcctcgccacgaccaccaccaccaccatgtcgtcgccttcctctcgccacccctcgtca
ccancgctctctacaaatgccagagctccggccacccccaccaccacccaagaagcctgc
gccgccgaccggcatcgcgacatgggcgacgccgcggtacccgccatggtggtggaggag
gaggaacaggagcacgtgttccggagcaggttcccgccggtggccgtgccggacggcgtc
accgtgccggagttcgtgctggacggcgccgaggcctacgccgacagggtggcgctcgtg
gaggccgcggcgggcgggcggtcgtacacgtacggcgaggtggcgcgcgacacggcgcgg
ttcgccagggcgctccggtcggtgggcgtccggaaggggcacgtcgtcgtcgtcgcgctc
ccaaacctcgccgtgtaccccgtcgtgtcgctcgggatcatgtcggcgggggccgtgttc
tccggcgtgaacccgcgcgcgctcgccgcggagatcaagaagcaggtggaggactccgag
gcgaagctggtcgttgccaacgaggtcgcgttcgacaaggtgaaggacgccggcgtgccg
gtgatcggcgtcggcgacagggagcggatgcctggggcgatcagctgggacgggctcctc
gccgcggcggaccgcaccggcgccggggtggtgccggtggacgcggcgcagcagtccgac
ctgtgcgcgctcccctactcctccggcaccaccggcgtgtccaagggcgtgatgctgagc
caccgcaacctggtgtccaacctctgctcgtccatgttcgccgtggcgccggagacggcc
gggcaggtggtgacgctggggctcatgccgttcttccacatctacggcatcaccggcatc
tgctgcgccacgctccggcacaagggcacggtggtggtgatggaccgcttcgacctccgc
acgttcctccgtgcgctcgtcgaccaccgcgtcatgttcgcgccgctggttccccccgtg
atgctcgccatggtcaagagccccgtcgccgacgagttcgacctctccgacctcgccctc
aagtccgtcatgaccgccgccgcgccgctcgcccccgacctcctcgccgcgttccagcgc
aagttccccggcgtgcaggtggaggaagcctacggcctcaccgagcacagctgcatcacc
ctcacgcacgccgccggcgacggccacggccacgtcgccaagaagagctcggtggggttc
atcctgccgaacctggaggtgaagttcgtggacccggacaccgggaggtcgctgccggcg
aacacgccgggggagctgtgcgtgcggagccagagcgtgatgcaggggtactacaagagg
aaggaggagacggagcgcacggtggacggcaaggggtggctgcacaccggcgacgttggg
tacatcgacggcgacggcgacgtgttcatcgtggacaggatcaaggagctgatcaagtac
aaggggtttcaggtcgcccccgccgagctcgaggccgtcctcctctcccacccctccgtt
gaggacgccgccgtcttcggggtgccggacgaggaggccggcgaggtgccggtggcgtgc
gtggtgcggcggcacggtgcggaggagggggaggaggagatagtggcgtacgtggcggag
agggtggcgtcgtacaagcgggtccgggtgctgcacatcgtcgacgccatccccaagtcg
gtgtccgggaagatcctgaggaggcagcttagggacgagttcatcaagaggatgaaaccg
tcagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9269113
Entry
9269113           CDS       T01015                                 
Name
(RefSeq) 4-coumarate--CoA ligase-like 3
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    9269113
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9269113
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     9269113
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 9269113
NCBI-ProteinID: XP_015650198
UniProt: Q6YYZ2
LinkDB
Position
8:2382080..2385366
AA seq 591 aa
MQRDAIAAARNAGCSSGRISQPPPPPFYSAATGIYSSIHPPVALPTDPSLTLVAHLFARL
PLADPGAPTLVDAATASAVSRADLRRLVASLAAGLRRRHGVRKGSVVLLLLPNSVAFPVS
FLAVLAAGAVATTMNPSSSPAEIAAQARATGACLVLASRDGAARLPPLAAPVVLVPEILD
HSAAADDGDDDQRVFAAFRAMLDGGGGDGTETAVPVVGQDDAVAILYSSGTSGRSKGVVL
THRNLIAMTELFVRFEASQYHARGARENVYMAALPMSHVYGLSLFAVGLLSIGATVVVMR
RFDAGDAVAAIGRYKVTHMPLVPPIMAAMVRAAAAGGVPPSQVASLVQVSCGAAPITAAL
IHEFLQAFPHVDFIQGYGMTESTAVGTRGFNTSKHKKYTSVGLLAPNMHAKIVHLESSSC
LPPGFSGELWLHGPGIMKGYLSDDDDACTRKDGWLRTGDIAYFDLDGYLYIVGRLKDTIK
YKGFQIAPGDLEEVLIHHPEILDVAVTSAEDEEAGEIPVAFVVRRSGSNLSCKQVMEYVA
KQVAPYKRVRKVVFVEAIPKSPAGKVLRRLLRNSHDTAAAATSSCSISSKL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgcagcgcgacgcgatcgccgccgcccggaacgccggctgctcgagcggccgcatctcg
cagccgccgccgccgccgttctactccgccgccaccggaatctacagcagcatccaccct
cccgtggcgctccccaccgacccctccctcaccctcgtcgcccacctcttcgcccgcctc
cccctcgccgacccgggcgcccccaccctcgtcgacgccgccaccgcgtccgcggtgtcc
cgcgccgacctccgccgcctcgtcgcctccctcgccgcggggctccgccgccgccatggc
gttcggaaggggtccgttgtgctgctgctcctcccgaactccgtcgcgttccccgtctcg
ttcctcgccgtgctcgccgccggcgccgtcgccaccaccatgaacccctccagctccccc
gccgagattgccgcccaggcgcgggccaccggcgcatgcctcgtcctcgcctcgcgcgac
ggcgccgcgaggctcccgcctctcgctgcccccgtcgtcctcgtgcccgaaatcctggac
cattccgccgcggccgacgacggcgacgacgaccaacgcgtgttcgccgcgttccgcgcc
atgctcgacggcggcggcggcgacggcaccgagacggcggtcccggtggtgggccaggac
gacgcggtggccatcctctactcgtcggggacgtcggggaggagcaagggggtggtgctg
acgcaccgcaacctgatcgccatgacggagctgttcgtccggttcgaggcgtcgcagtac
cacgcgcgaggtgctcgcgaaaatgtctacatggcggcgctgcccatgtcccacgtgtac
ggcctctccctcttcgccgtcggcctcctctcgatcggtgccacggtggtggtgatgagg
agattcgacgccggcgacgccgtcgccgccatcgggaggtacaaggtgacgcacatgccg
ctcgtgccgcccatcatggcggccatggtcagggccgccgcggccggcggcgtgccgccg
tcgcaggtggcctcgctggtgcaggtctcgtgcggcgcggctccgatcaccgccgcgctc
atccacgaattccttcaggctttcccccacgtcgacttcattcagggttatggcatgaca
gaatctactgccgtaggaactcgcggatttaacactagcaagcacaaaaagtatacctcg
gtaggccttttggcccccaacatgcacgccaagattgttcatcttgagagtagttcatgt
ttgcctccaggcttctcaggggagctatggctccatggcccaggaatcatgaaaggttac
ttgagtgatgatgatgatgcctgcacgagaaaggatggctggttgcgtaccggagacatt
gcctactttgatctggatggctacctatacattgtaggccgcttgaaggacacaatcaag
tacaaaggatttcagatagctccgggggacttggaagaagttttgatccaccaccctgaa
attcttgatgttgctgtgacatctgctgaggatgaagaagctggagagataccagtagct
tttgtggtgaggagatctggaagcaacctttcttgtaagcaagtgatggagtatgtggcc
aagcaggttgctccatataagagagtgaggaaggtggtatttgtggaggcaattcccaag
tcacctgctggaaaagttttgaggaggcttctcaggaactcgcatgacactgctgctgct
gctacctcttcttgcagtatcagctccaagctctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9272068
Entry
9272068           CDS       T01015                                 
Name
(RefSeq) 4-coumarate--CoA ligase-like 2
  KO
K01904  4-coumarate--CoA ligase [EC:6.2.1.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00130  Ubiquinone and other terpenoid-quinone biosynthesis
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
osa_M00137  Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    9272068
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9272068
Enzymes [BR:osa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.12  4-coumarate---CoA ligase
     9272068
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF6713
Other DBs
NCBI-GeneID: 9272068
NCBI-ProteinID: XP_015614233
UniProt: A0A0P0XXS5
LinkDB
Position
10:complement(23082821..23086791)
AA seq 558 aa
MQPDAAATAHPSLSFYSAATGLYSSLHPPLPLPSDPSLSLVPHLFSHLPLHHHSLLVDAP
TAATLSCADFRRLVSSLAAGLRRRLHIARGSLVLLLLPNSLTFPVAFLAVLATGAVATTM
NPSSAPAEIAARLRDTAPSLVLASTHNAAKLPPLAAPLVLVPDTFQQQHDDDQFDFFFHA
LLETDPETPVEMGVGVGQDDAAAVLYSSGTSGRSKGVVVTHRNLIAMVELFVRFEASQYT
RPARDNVYLAALPMFHVYGLSLFAVGLLSLGCTVVVMRRFNVDDAVKAIRKYKVTHLPLV
PPIMSALLRANPPLELDSLLQVSSGAAPLNHTLIHHFLHAFPHVDFIQGYGMTESTAVGT
RGFNTCKHKKYASVGLLAPNMHAKIVHLESGSCLPPGSYGELWLHGPAIMKGYLNDDDDA
FTRKDGWLRTGDIAYFDSDGYLFIVGRLKDTIKYKGFQIAPADLEAVLIRHPEIIDVAVT
SDEDEEAGEIPVAFVVRKSGSTLSCTHVMEYVAKQVASYKRVRKVIFVEAIPKSAAGKVL
RRLLKDSLVDASSGRSRL
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcagcccgacgccgccgccaccgcccaccccagcttgagcttctactccgccgccacg
ggcctctacagcagcctccaccctcccctacccctcccctccgacccctctctctccctc
gtcccccacctcttctcccatctccccctccaccaccattccctcctcgtcgatgccccc
accgccgccaccctctcctgcgccgacttccgccgcctcgtctcctccctcgccgccggc
ctccgccgccgcctccacatcgccaggggatccctcgtcctgctcctcctccccaactct
ctcaccttccccgttgccttcctcgccgtcctcgccaccggcgccgtcgccaccaccatg
aacccctccagcgcccccgccgagatcgccgcgcgcctgcgggacaccgccccctccctc
gtgctcgcctccacccacaacgccgctaagcttccgcctctcgccgccccgctcgtcctc
gtgcccgacaccttccagcagcaacatgatgatgatcagttcgacttcttcttccacgcg
ctgctcgagaccgaccccgaaacgccggtggagatgggggtgggggtggggcaggacgac
gccgccgccgtcctctactcgtcggggacgagcgggcggagcaagggcgtggtggtgacg
caccgcaacctgatcgcaatggtggagctgttcgtgcggttcgaggcgtcgcagtacacg
cggcctgctcgtgacaatgtctacctggcggcattgcccatgttccacgtctacggcctc
tccctcttcgccgtgggcctcctctcgctcggctgcacggttgtcgtgatgaggaggttc
aacgtcgacgacgccgtcaaggccatccgcaagtacaaggtgacgcacctgccgctcgtg
ccgcccatcatgtcggcactgctcagggccaacccgcccttggaattggattccttgctg
caggtctccagcggcgctgctcccctcaaccacaccctcattcaccacttccttcacgcc
ttcccccacgttgatttcattcaggggtatggcatgactgaatctactgccgtaggaact
cgcggcttcaatacatgcaagcacaagaagtatgcctcagtaggtcttttagcccccaac
atgcatgctaaaattgttcatctggaaagtggttcttgtctgcctccaggctcttatggg
gagttatggctccatggcccggctataatgaaaggttacttgaatgatgatgatgatgct
ttcactagaaaggatggctggttgaggactggtgatattgcttactttgattcagatggg
tatttgttcatagtgggtcgcttgaaagacacaatcaagtacaaaggatttcagatagct
ccagctgacttggaagctgttctgatccggcaccctgaaattattgatgttgctgtgaca
tctgatgaagatgaagaagctggagagatacctgtagcttttgtggtgagaaaatctgga
agcactctttcttgtacgcatgtcatggagtatgtggccaagcaggtggcgtcgtataag
agagtgaggaaggtaatattcgtggaggcgatacctaagtcagctgctggcaaggttctg
aggaggcttctcaaggactctcttgttgatgcttccagtggcagatccaggctatga

DBGET integrated database retrieval system