KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328488
Entry
4328488           CDS       T01015                                 
Name
(RefSeq) FGGY carbohydrate kinase domain-containing protein
  KO
K00875  D-ribulokinase [EC:2.7.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    4328488
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.47  D-ribulokinase
     4328488
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 4328488
NCBI-ProteinID: XP_015626125
LinkDB
Position
2:4302074..4306972
AA seq 577 aa
MPPGGGGAVFLGVDVGTGSARAGLFDEKGKLLGSASSPIQIWKEKDCIEQSSTDIWHAVC
AAVKHACSLANVAPENVVGLGFAATCSLVAVDADGSPVSVSWTGDARRNIIVWMDHRAVD
QAERINARNSPVLQYCGGGVSPEMQAPKLLWVKENLQESWSMVCRWMDLSDWLAYRATGD
DTRSLCTTVCKWTYLGHAHMEQWKESDSRDMEACGWDEVFWEEIGLGDLVEGNHAKIGRS
VAFPGHPLGSGLTATAAKELGLRPGIPVGTSLIDAHAGGVGVMESVPDAESKADTSDESD
EQAICHRMVLVCGTSTCHMAVSKNKLFIPGVWGPFWSAMVPEFWLTEGGQSATGALLDYI
VENHVAAPLLANHAASQRISIYELLNKILFSMAHEQNISFISSLTQDIHVLPDFHGNRSP
LADPKSKGIICGFTLDTSEKHLALLYLATIQGIAYGTRHIVEHCNAHGHKIDTLLACGGL
AKNSLYIQEHADITGCPIILPRENESVLLGAAVLGAVAAKKFPGVRDAMKALNAAGKVVY
PSSDPRVKKYHDAKYQIFRSLYEQQLSHRSAMAQALQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgccccccggcggcgggggcgccgtcttcctcggagtcgacgtcggcaccggcagcgct
cgcgcaggtctctttgatgagaagggtaagctgctggggtcggcgagcagtcctatacag
atatggaaggagaaggactgcatcgagcaatcatcaacagacatatggcatgccgtgtgt
gctgcggtaaaacacgcatgctctctggcaaatgttgcgcctgagaatgttgtcggactt
ggcttcgccgctacttgttctcttgttgctgttgatgctgatggttcccctgtttctgtt
tcttggactggtgatgcgaggaggaacatcatcgtgtggatggaccatagggctgtagac
caagctgagcgaatcaatgctcgcaattcgccggtattgcaatactgtggtgggggtgtt
tccccagaaatgcaagccccaaagctcttatgggtaaaggaaaatctgcaagagtcgtgg
tcaatggtatgtaggtggatggacctcagtgattggttagcatatagagcgactggcgat
gacacacgcagcttatgcacaactgtttgcaaatggacatatcttgggcatgcacacatg
gaacagtggaaggaatcagattcacgtgatatggaagcatgtggatgggatgaagtcttt
tgggaagaaataggcttgggagaccttgttgaaggaaatcatgcaaaaataggacgcagt
gttgcatttcctggccatcctctgggttctgggttgacagctactgctgccaaggagtta
ggtttgcgtcctgggattcctgttggaacttcactaattgatgctcatgctggtggtgtt
ggagtcatggaaagtgtgccagatgcagaatctaaagctgacacgtctgatgaatctgat
gaacaagctatatgccaccgcatggtcttggtttgtgggacatctacatgccatatggct
gtctcaaagaacaaactgtttatccctggtgtctgggggccattttggtctgcaatggtt
cctgagttttggctcacggaaggtggccaaagtgcaactggtgctctacttgattacatt
gttgaaaaccatgttgctgctcctcttcttgctaatcatgctgcttctcaaagaatatcc
atatatgagctactgaacaagatactattttctatggcacatgagcaaaatatttctttt
atttcttccctgactcaagacatccatgtcctcccagattttcatggaaataggtctcct
ttggctgatccaaaatccaaaggaatcatatgtggcttcacacttgatacaagtgagaag
cacttggcgcttctttatctagcaacaattcaaggcattgcttatggtactcgtcatatt
gtggagcattgcaatgctcatgggcacaagatcgatactcttcttgcttgtggcggactt
gcgaagaattccttgtatatccaagagcacgcagatataactggatgtccaataatactt
cctagagagaatgagtctgtgcttttaggagctgctgtcctgggtgctgttgctgcaaag
aagtttccaggtgttcgcgacgcaatgaaggcactgaatgcggccgggaaggttgtatat
ccatcttcagatcctagggtaaagaaataccatgatgcaaaatatcagatattcagatcc
ctgtatgagcaacaactctcccatcgctcagctatggcacaggcattgcagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267504
Entry
9267504           CDS       T01015                                 
Name
(RefSeq) xylulose kinase isoform X1
  KO
K22935  D-ribulokinase [EC:2.7.1.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00040  Pentose and glucuronate interconversions
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    9267504
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.47  D-ribulokinase
     9267504
SSDB
Motif
Pfam: FGGY_C FGGY_N
Other DBs
NCBI-GeneID: 9267504
NCBI-ProteinID: XP_015646954
LinkDB
Position
7:12762664..12766737
AA seq 477 aa
MPIASVSAKPLSHLPAKRGSSRFTTKGTSRVRVMMLRQKNPGGQKKSFDGTGEPLYLGID
FGTSGARYALVDKQGAIHSEGKRTYPPVGRVTNWASSWREALFHLLGNIPAIYRPSISSI
SIDGTSATTFIIDRNNGGILAGPYLYNESFADALPAVESIAPANHTVRSGSSTLCKLVSW
WNSSSAGLSSRDSAILMHQSDWLLWLLHGEYGVSDYNNTLKVGYDPEIDSYPSWLMSQPY
AYMLPSVRAPGAPIGSIKEDVRAQFGFPKNCVVCTGTTDSIAAFLAARTTEPGKAVTSLG
STLAIKLLSNARVDDARFGVYSHRLDDMWLVGGASNTGGAVLRQLFTDDQLVALSHEIDP
SVPSLLDYYPLPKRGERFPVSDPNMMPRLQPRPESDTAYLHGILESIARIEAKGYNLLKE
LGASMVEEVLTAGGGARNDKWTAIRGRVLGVPVRKAEQTEAAYGAALLALKGANTTH
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgccaattgccagtgtctctgccaagcctctgtctcacctccccgcaaaacgaggatca
tccaggttcacaacgaaaggtacatcaagagtaagggttatgatgcttaggcaaaaaaat
ccgggaggccagaagaagagctttgatggaacaggcgagcctctatatcttgggatagac
tttggaacttcaggtgccagatatgctcttgtcgataagcaaggggccatacattctgaa
ggcaaaagaacttaccctcctgttggtagagtcacaaactgggcaagctcctggagagaa
gctctcttccatcttctgggtaatatcccagccatctaccggccatccatctcttccatt
tcaatcgacgggacttcagccaccactttcatcatcgacaggaacaatggagggattctt
gctggcccatatctctacaacgagagcttcgcagacgcgctgccagcagtcgaatcgatt
gccccggcaaatcatacggtgcgttctggttcgtccaccctgtgcaagcttgtgtcatgg
tggaattcgagctcagcaggcttgagcagtagagattcagcgatactgatgcaccagtca
gactggttgctctggcttttgcatggagaatatggtgtttctgattataacaacactctg
aaggtgggctacgatccagagattgactcgtacccaagttggttgatgtcacagccatat
gcttacatgttgccgtctgttagagcacccggagctccaattggctcaatcaaggaggat
gtacgcgcacagtttggatttcccaagaactgcgtggtctgtactggaacaacggacagc
atagccgcttttctcgcagcgcgcaccacagagcccgggaaagctgtgacgtcgttgggt
tcaactctggcgatcaagctgctgagcaacgcccgcgtggacgacgcgcggttcggcgtg
tacagccatcggctggacgacatgtggctggtcgggggcgcgtccaacaccggcggcgcc
gtcctcaggcagctcttcaccgacgatcagctcgtcgctctcagccacgagatcgacccg
tcggttccttcccttctcgattactaccctctgcctaagagaggagaaaggttccctgtc
tccgaccccaacatgatgccaaggctgcagcctaggccggagagcgacacggcgtacttg
catggcatactggagtcgatcgcgcggattgaggcaaaggggtacaatctgttgaaggag
ctcggcgcgagcatggtggaggaggttttgacggcgggtggaggagctcggaacgataag
tggacggcgataaggggaagggtgcttggcgttccggtgagaaaggcggagcagacggag
gcggcctacggggctgcactgctagcactcaagggtgctaatactacgcactag

DBGET integrated database retrieval system