KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328492
Entry
4328492           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit gamma
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4328492
   04141 Protein processing in endoplasmic reticulum
    4328492
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4328492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4328492
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4328492
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-GeneID: 4328492
NCBI-ProteinID: XP_015626276
UniProt: P38385
LinkDB
Position
2:4332258..4334368
AA seq 69 aa
MDAVDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAARTAIGFVVMGFVGFFVKLIFIP
INNIIVGSG
NT seq 210 nt   +upstreamnt  +downstreamnt
atggacgccgtcgactcggtggtcgacccgctgcgcgagttcgccaaggacagcgtccgc
ctcgtcaagcgctgccacaagcccgaccgcaaggagttcaccaaggtggcggcgaggacg
gcgatcgggttcgtcgtcatgggcttcgtcggcttcttcgtcaagctcatcttcatcccc
atcaacaacatcatcgtcggatccggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341707
Entry
4341707           CDS       T01015                                 
Name
(RefSeq) protein transport protein Sec61 subunit gamma-like
  KO
K07342  protein transport protein SEC61 subunit gamma and related proteins
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
osa04141  Protein processing in endoplasmic reticulum
osa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4341707
   04141 Protein processing in endoplasmic reticulum
    4341707
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4341707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4341707
Secretion system [BR:osa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   4341707
SSDB
Motif
Pfam: SecE
Other DBs
NCBI-GeneID: 4341707
NCBI-ProteinID: XP_015643087
UniProt: B9FQ98 Q67WC8
LinkDB
Position
6:complement(26782892..26784860)
AA seq 69 aa
MDAIDSVVDPLREFAKDSVRLVKRCHKPDRKEFSKVALRTAIGFVVMGFVGFFVKLIFIP
INNIIVGSG
NT seq 210 nt   +upstreamnt  +downstreamnt
atggacgccatcgactccgtggtggatcccctccgcgagttcgccaaggacagcgtccgc
ctcgtcaagcgctgccacaagcccgaccgcaaggagttctccaaggtggcgttgcggacg
gcgatcgggttcgtcgtcatgggattcgtcggcttcttcgtcaagctaatcttcatcccc
atcaacaacatcatcgtcgggtccggctag

DBGET integrated database retrieval system