KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328500
Entry
4328500           CDS       T01015                                 
Name
(RefSeq) ubiquitin receptor RAD23b isoform X1
  KO
K10839  UV excision repair protein RAD23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4328500
  09124 Replication and repair
   03420 Nucleotide excision repair
    4328500
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328500
   03400 DNA repair and recombination proteins [BR:osa03400]
    4328500
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    4328500
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      4328500
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD UBA_3 Ubiquitin_4 KIP1 DUF2868 Dsc3_N
Other DBs
NCBI-GeneID: 4328500
NCBI-ProteinID: XP_015622748
LinkDB
Position
2:4407946..4412775
AA seq 370 aa
MKLTVKTLKGTQFEIRVQPNDTIMAVKKIIEEIQGKDSYPWGQQLLIHNGKVLKDESTLE
ENKVSEVGFLVVMLSKSKASGSSGALSSLTSSTPLTRQETPADASRAAPQPLVAPTRTPQ
PERPPAEAPSNAYGQAASNLLSGSNLDTTINQLMEMGGGSWDRDKVQRALRAAYNNPERA
VEYLYSGIPITAEVAVPAGGQGANTTEPSSTREASLSGIPNASPLNLFPQQGDANDGGGA
GGGTLEFLRHNQQFQALREMVHTNPQILQPMLQELSKKNPQLLRLIQENHDEFLQLINEP
FDGADGDFLDQPDQDEMPHSINVTPEEQEAIGRLEGMGFDRARVIEAFFACDRNEQLAAN
YLLEHAADED
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaagctgacggtgaagaccctcaagggcacccagttcgagatccgggtgcagcccaac
gacaccattatggctgtcaagaagatcattgaagagatacaaggaaaggatagctaccca
tggggccaacagttgctgattcacaatggcaaggttttgaaagatgaaagtacattggaa
gagaacaaagtcagtgaagttgggtttttagttgtcatgcttagtaagagtaaagcttct
ggttccagtggagctttaagttcactgacttcaagcacccctttgaccaggcaagaaact
cctgcggatgcttcacgagcagctcctcaacccctagttgcacctacaagaacaccccag
cccgaaaggccacctgcggaagccccttcaaacgcatatggtcaagcagcatcaaatcta
ttgtcgggaagcaatcttgacactacgattaaccagctgatggaaatgggtggtggcagt
tgggacagagataaagtccaaagagctctacgtgcagcttataacaacccagagcgtgct
gttgaatatctatattctggcattccaattacagcggaggttgctgttccagcaggtggt
caaggggcaaacacaaccgagccatcttctactagggaagccagtctgtctggaattcca
aacgcatccccgttaaatcttttcccacagcagggcgatgcaaatgatggaggtggtgct
ggtggtggaacacttgagttccttagacataaccaacagtttcaggcgcttcgggaaatg
gttcatactaacccacaaatattgcagcctatgctccaggaactgagcaagaagaatcct
caacttctgaggttgattcaggagaaccatgatgagttccttcagttaataaatgagccc
tttgatggtgctgatggggacttcttagaccaacctgaccaggatgagatgccccattct
atcaatgtcacacctgaagagcaagaggcgattggacggcttgaaggcatgggatttgac
agagcacgtgtcatcgaagcattcttcgcctgtgacaggaacgagcaactcgcagcaaat
taccttcttgaacatgctgctgatgaagattag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340699
Entry
4340699           CDS       T01015                                 
Name
(RefSeq) ubiquitin receptor RAD23d
  KO
K10839  UV excision repair protein RAD23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4340699
  09124 Replication and repair
   03420 Nucleotide excision repair
    4340699
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4340699
   03400 DNA repair and recombination proteins [BR:osa03400]
    4340699
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    4340699
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      4340699
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Dsc3_N Rad60-SLD_2 UBA_3 STI1
Other DBs
NCBI-GeneID: 4340699
NCBI-ProteinID: XP_015643927
UniProt: Q5Z6P9 A3BAG6
LinkDB
Position
6:8720563..8726647
AA seq 413 aa
MKLFVKTLKGTNFEIEASPEASVAEVKRIIESTQGQNVYPADQQMLIHQGKILKDDTTLE
GNKVAENSFLVIMLSKAKASSSGASTASKAPVSQSQPATPVASVARTPPPQAPVVTPEPA
PPSAQPPVASATPAAAATPAAAVTASSDADVYSQAASNLVSGSNLEQTIQQILDMGGGTW
ERDMVVRALRAAYNNPERAIDYLYSGIPENVEPPQPVARAPAAVQQGNPQVPSQAQAAPP
PPVQPAGGASGPNANPLNLFPQGIPSAGSNPGAAAGAGAGAGALDALRQLPQFQALLALV
QANPQILQPMLQELGKQNPQILRLIQENQAEFLRLVNESPDSGAAGGNILGQLAAAMPQA
LTVTPEEREAIQRLEAMGFNRELVLEVFFACNKDEELAANYLLDHGHEFEDQQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaagctgttcgtgaagaccctgaagggcaccaacttcgagatcgaggcgagccccgag
gcgtcggtggctgaggtgaagagaatcattgagagtactcaggggcagaatgtgtacccg
gcggatcagcagatgctcatacaccaagggaaaattctcaaggatgatacaactttggaa
ggcaacaaagttgctgagaacagcttccttgttataatgctgtctaaggccaaagcatca
tcaagtggagcttcaactgcttcaaaggcacctgtgagccagtctcaaccagcaactcca
gttgcctcagttgcaagaacaccacctccacaagcacctgttgttacacctgaaccggca
cctccaagtgcacagcctccagttgcttctgccactccagctgctgctgccactccagct
gctgctgtgaccgcatcaagtgatgcggatgtctacagtcaggctgcatcaaatcttgtt
tcaggtagcaacctagaacagacaatccaacaaattcttgacatgggtggtggcacctgg
gaacgtgacatggttgtccgtgctttgcgtgctgcatataacaaccctgagagagctatt
gactatctgtattctggaattcctgagaatgtggagcccccacaacctgtggctcgagca
cctgctgctgttcaacagggaaatccacaggttccatctcaggctcaggctgcacctcca
ccgcctgtgcagccagctggtggtgcctcaggacctaatgcgaatcctctaaacctattc
ccccagggcattccaagtgctgggtcaaatcctggtgctgctgctggtgccggtgccggt
gctggtgcccttgatgcattgcgacaacttccacagttccaagcgctgcttgcattggtc
caggctaatccccaaatcttgcagccaatgcttcaagagcttgggaagcagaatccgcaa
atcttgcggttgattcaggaaaatcaggctgaatttctccgtctggtgaatgaatctcct
gatagcggcgctgctgggggaaacatactaggtcaactagcagccgctatgccacaggca
cttacagttactccagaggaacgggaggccattcagcggctggaggcaatggggttcaac
cgtgagctcgttttggaggtcttcttcgcatgcaacaaggatgaagagctggctgccaac
tatcttttggatcatggccatgagtttgaggatcaacaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345632
Entry
4345632           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin receptor RAD23 isoform X1
  KO
K10839  UV excision repair protein RAD23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4345632
  09124 Replication and repair
   03420 Nucleotide excision repair
    4345632
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4345632
   03400 DNA repair and recombination proteins [BR:osa03400]
    4345632
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    4345632
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      4345632
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Ubiquitin_4 Rap1_C UBA_3
Other DBs
NCBI-GeneID: 4345632
NCBI-ProteinID: XP_015650876
UniProt: Q6ZKC1 A3BTC8
LinkDB
Position
8:20796971..20801711
AA seq 406 aa
MKVSIKTLKGSSFEIDVEPTSKVSDVKKLIEVTQGDNVYPADQQMLIHQGNVLKNDTTLE
ENKVVENNFIVIMLSKKGSSSAASSTAKEPTKQPSVDRAIPTAPATQPPAPPAPVSEPVT
APVPTATTASAPAAAVTAASTEADNYGQAASNLVAGSNLEGTVQSILEMGGGAWDRDTVM
RALRAAYNNPERAVEYLYTGVPEQAEAPAAVQALPVPAAVQALPVPAAVQPVDPSQAPQS
AQLSIPSSGPNANPLDLFPQVLPNASANAGGGNLDVLRNNSQFRGLLSLVQANPQILQPL
LQELGKQNPQILQLIQENQAEFLRLINEPAEGAEGNLLDQFAAGMPQTVAVTPEENEAIQ
RLEQMGFDRDLVLEVFFACNKDELLAANYLLDHMNEFDDDAPEPPQ
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaaggtctccatcaaaacgctcaagggctccagcttcgagatcgacgtcgagcccacc
agcaaggtcagtgatgttaaaaagctcatcgaggttacgcaaggagataatgtctacccc
gctgatcagcaaatgctgatccatcaagggaatgtccttaaaaacgacacaacacttgaa
gagaacaaagttgttgagaacaacttcattgtgataatgttatctaagaagggatcatca
agtgctgcttcaagtacagctaaggagcccacaaaacagccctcagttgaccgggcgata
cccactgcgcctgcaacccaaccacctgctccaccagcacctgttagcgagcctgtgact
gcaccagttccaactgcaacaactgcttcagctccagcagctgctgtcaccgctgcatcc
accgaagcagataattatggtcaagctgcgtcgaaccttgttgctggaagcaatttagaa
gggactgttcagtcaattcttgaaatgggtggaggagcttgggaccgtgacactgttatg
cgtgctctgcgagctgcatacaacaatccagaacgggctgtggagtatttgtacaccggg
gttcctgagcaagctgaggcccctgctgcagttcaagcacttcctgtccctgctgcagtt
caagcacttcctgtccctgctgcagttcaaccagttgacccaagccaggctccccaatca
gctcaactttcaattccatcatctggacccaatgccaatccattggacctgtttcctcag
gtccttccaaatgcttctgcaaatgctggtggtggaaatcttgatgttctgcgaaacaat
tcacagttccgtggcttgctttctttggtgcaggctaaccctcaaattctgcagcctttg
cttcaagagttggggaaacaaaatccacagattttgcaactgattcaggaaaaccaggct
gagttcctgcgcttaatcaacgaacctgcagagggagctgaagggaacttgctagaccag
tttgctgcgggaatgcctcaaacagtggctgtcacacctgaggagaacgaagccatacaa
cgtctggaacaaatggggtttgatcgcgatctggtcctggaggtattcttcgcgtgcaac
aaggatgagctgttggccgcaaactatctcttggaccacatgaacgagttcgacgacgac
gcccctgaaccaccgcaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347014
Entry
4347014           CDS       T01015                                 
Name
(RefSeq) probable ubiquitin receptor RAD23 isoform X3
  KO
K10839  UV excision repair protein RAD23
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    4347014
  09124 Replication and repair
   03420 Nucleotide excision repair
    4347014
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4347014
   03400 DNA repair and recombination proteins [BR:osa03400]
    4347014
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   UBL-UBA shuttle proteins
    4347014
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     XPC-HR23B-CETN2 complex
      4347014
SSDB
Motif
Pfam: UBA XPC-binding ubiquitin Rad60-SLD Ubiquitin_4 Dsc3_N Crinkler Pro_racemase
Other DBs
NCBI-GeneID: 4347014
NCBI-ProteinID: XP_015611791
UniProt: Q40742
LinkDB
Position
9:14362998..14366949
AA seq 392 aa
MKISVKTLKGSTFQIEVDSAQKVADVKRIIETTQGQHIYPAEQQMLIHQGKVLKDDTTLD
ENKVLENSFLVIMLRQGKGSSSSAPATSKAPSNQAPPTQTVPAAPASQAPVAPATTVPVT
VSAPTPTATASPAPAVAVSSEADNYGQATSNLVAGSNLEATIQSILEMGGGIWDRDIVLH
ALSAAFNNPERAVEYLYSGVPEQMDIPVPPPSIQPANPTQASQATQPAAPSILSSGPNAS
PLDLFPQALPNASTDAAGLGNLDALRNNAQFRTLLSLVQANPQILQPLLQELGKQNPQIL
QLIQENQAEFLHLINEPAEGDDEENLLDQFPEAMPQTIAVTPEENEAILRLEAMGFDRAL
VLDVFFACNKDEQLAANYLLDHMNEFDDEGPP
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgaagatatccgtgaagacactcaagggatccaccttccagatcgaggtggactccgcg
cagaaggttgctgatgtgaaaaggataatcgagactactcaaggacagcacatttaccca
gctgagcaacagatgctcattcatcaggggaaggtgctcaaggatgacaccacattggat
gaaaacaaagttcttgaaaacagcttccttgttataatgcttagacagggtaagggctca
tcaagttcagctcctgctacatctaaggcaccctcaaatcaggctccccctactcaaaca
gtgcctgcagctcctgcatctcaagcaccagttgcaccagcaactactgtacctgtcact
gtcagtgctcctaccccaactgccacagcttccccagctcctgctgttgctgtatcctct
gaagctgataactacggtcaggccacctcaaaccttgttgctggcagcaatctagaggca
acaattcaatcaattcttgaaatgggtggtggaatatgggatagagacattgtgctgcat
gctctaagcgctgcattcaacaacccggagagggctgttgaatatctgtactctggtgtt
cctgagcagatggacattccagttccacctccgagtatacagccagccaatcctacccag
gcttcacaggcaactcaaccagcagctccatcaattctttcgtctggaccaaacgctagt
cccttggacctctttcctcaagcccttccaaatgcttccaccgatgctgctggtctagga
aatcttgatgctttgcgcaataatgcacaattccgaaccttgctttctttagtgcaagcc
aatcctcaaattttacagccattgcttcaagaattggggaaacaaaatccccagattttg
cagctgattcaggaaaaccaagctgagttcctccacttaatcaatgaaccagctgagggt
gatgatgaagagaatttgctagaccagtttccagaggcaatgccacagaccatagcagtt
actccagaggagaatgaagccatacttcgtcttgaagcaatgggctttgaccgcgcgctt
gttctggacgtgttcttcgcttgcaacaaggacgagcagctggcggcaaactatctccta
gatcacatgaacgagttcgacgacgaggggccaccataa

DBGET integrated database retrieval system