KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328517
Entry
4328517           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-3-like
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4328517
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4328517
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4328517
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4328517
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4328517
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4328517
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 4328517
NCBI-ProteinID: XP_015627704
UniProt: Q6H800 A0A0P0VFM2
LinkDB
Position
2:complement(4598621..4601422)
AA seq 204 aa
MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA
QTLYQRLVFRHKLYQLREERDMKPQAFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI
CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPSMEPEELFETISQALQASVDRDCLS
GWGGYVLLVTPTEVQERVIKGRMD
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtcgatcttcgagtacaacgggagcgccgtggtggcgatggtggggaagaactgcttc
gcgatcgccagcgaccggcgcctcggggtgcagctgcagacggtcgccaccgacttccag
agggtgttcaagatccacgacaagctctacatcggcctctccggcctcgccaccgacgcc
cagacgctgtaccagcggctggtgttcaggcacaaactgtaccagctgagggaggagagg
gacatgaagccccaggcattcgctagcctcgtctccgcgctcctctacgagaagaggttt
gggccgtacttctgccaaccagttattgctggattaggagataatgatgagccatttata
tgtaccatggattgcattggtgccaaggaactagcgaaagattttgtggtttctggcact
gcttcagaatcactatatggtgcttgtgagtccatgtataagccaagcatggaaccggaa
gaactattcgagacgatctcacaagcgctgcaggcttctgttgatcgagattgcctgagt
ggctggggtggttatgttctccttgtgactcccacagaggttcaggagagagtgatcaag
ggaaggatggactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341637
Entry
4341637           CDS       T01015                                 
Name
(RefSeq) proteasome subunit beta type-3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03050  Proteasome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    4341637
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4341637
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:osa03051]
    4341637
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     4341637
Peptidases and inhibitors [BR:osa01002]
 Threonine peptidases
  Family T1: proteasome family
   4341637
Proteasome [BR:osa03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    4341637
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 4341637
NCBI-ProteinID: XP_015641231
UniProt: Q9LST7
LinkDB
Position
6:complement(26199533..26202843)
AA seq 204 aa
MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA
QTLYQRLVFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGEDNEPFI
CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPNMEPEELFETISQALQSSVDRDCLS
GWGGFVLLVTPTEVKECVIKGRMD
NT seq 615 nt   +upstreamnt  +downstreamnt
atgtcgatcttcgagtacaatggttccgccgtggtggcgatggtggggaagaactgcttc
gcgatcgccagcgaccggcggctcggggtgcagctgcagaccgtcgcgacggacttccag
agggtgttcaagatccacgacaagctctacatcggcctctccggcctcgccaccgacgcg
cagacgctgtaccagcgcctggtgttcaggcacaagctgtatcaactgcgggaggagagg
gacatgaagccccagaccttcgccagcctcgtctccgctctcctctacgagaagagattt
ggaccatacttctgccagcctgttatcgctggacttggagaggacaatgagccatttatt
tgtaccatggactgcattggtgcaaaggaactagctaaggatttcgttgtatcggggaca
gcatcggagtctctatatggtgcttgtgagtccatgtacaaaccaaacatggaacctgaa
gaactctttgagactatctcacaagctctgcagtcatcagttgatcgtgattgcctcagt
ggttggggaggctttgttctgcttgtgacaccaaccgaagtaaaagagtgtgtgatcaag
ggcaggatggactaa

DBGET integrated database retrieval system