KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328552
Entry
4328552           CDS       T01015                                 
Name
(RefSeq) cinnamyl alcohol dehydrogenase 2
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4328552
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     4328552
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 Turandot 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 4328552
NCBI-ProteinID: XP_015626408
UniProt: Q6ZHS4
LinkDB
Position
2:complement(4870148..4874077)
AA seq 363 aa
MGSLAAEKTVTGWAARDASGHLTPYNYTLRKTGPEDVVVKVLYCGICHTDIHQAKNHLGA
SKYPMVPGHEVVGEVVEVGPEVTKYSAGDVVGVGVIVGCCRECHPCKANVEQYCNKRIWS
YNDVYTDGRPTQGGFASAMVVDQKFVVKIPAGLAPEQAAPLLCAGLTVYSPLKHFGLMSP
GLRGGVLGLGGVGHMGVKVAKSMGHHVTVISSSARKRGEAMDDLGADAYLVSSDAAAMAA
AGDSLDYIIDTVPVHHPLEPYLALLKLDGKLILMGVINQPLSFISPMVMLGRKAITGSFI
GSMAETEEVLNFCVDKGLTSQIEVVKMDYVNQALERLERNDVRYRFVVDVAGSNIDDADA
PPA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgggcagcctcgccgccgagaagaccgtcaccgggtgggccgccagggacgcctccggc
cacctcaccccctacaactacaccctcaggaagactgggcctgaagatgtggtggtgaag
gttttgtattgtggtatctgccatactgacatccaccaggccaagaaccaccttggtgct
tccaagtaccccatggtccctggccatgaggtggtcggcgaggtggtggaggtcgggccg
gaggtgaccaagtacagcgccggcgacgtcgtcggcgtcggcgtcatcgtcggctgctgc
cgcgagtgccatccgtgcaaggccaatgtggagcagtactgcaacaagaggatttggtcc
tacaacgacgtctacaccgacggccggccaacccagggcggcttcgcctccgccatggtc
gtcgaccagaagtttgtggtgaagatcccggcggggctagcgccggagcaggcggcgccg
ctgctgtgcgccgggctgacggtgtacagcccactgaagcacttcgggctgatgtcgcca
ggtctccgcggcggcgtcctggggctcggcggcgtggggcacatgggcgtgaaggtggcc
aagtcgatggggcaccacgtgacggtgatcagctcgtcggcgaggaagcgcggcgaggcc
atggacgacctgggcgccgacgcctacctcgtcagctccgacgcggcggcgatggcggcc
gccggcgactcgctggactacatcatcgacaccgtgccggtgcaccacccgctggagccg
tacctggcgctgctgaagctggacgggaagctgatcctgatgggggtgatcaaccagccg
ctgagcttcatctcgcccatggtgatgctcggccggaaggccatcaccggcagcttcatc
gggagcatggccgagacggaggaggtgctcaacttctgcgtcgacaaggggctcacctcc
cagatcgaggtcgtcaagatggactacgtcaaccaggccctcgagcgcctcgagcgcaac
gacgtccgctaccgcttcgtcgtcgacgtcgccggcagcaacatcgacgacgccgacgcg
ccgcccgcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335223
Entry
4335223           CDS       T01015                                 
Name
(RefSeq) probable cinnamyl alcohol dehydrogenase 6
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4335223
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     4335223
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N NAD_binding_7 Methyltransf_25 DUF5603
Other DBs
NCBI-GeneID: 4335223
NCBI-ProteinID: XP_015634191
UniProt: Q7XWU3
LinkDB
Position
4:complement(8637312..8639353)
AA seq 360 aa
MEVTPNHTQTVSGWAAMDESGKIVPFVFKRRENGVDDVTIKVKYCGMCHTDLHFIHNDWG
ITMYPVVPGHEITGVVTKVGTNVAGFKVGDRVGVGCIAASCLDCEHCRRSEENYCDKVAL
TYNGIFWDGSITYGGYSGMLVAHKRFVVRIPDTLPLDAAAPLLCAGITVYSPMKQHGMLQ
ADAAGRRLGVVGLGGLGHVAVKFGKAFGLHVTVISTSPAKEREARENLKADNFVVSTDQK
QMQAMTRSLDYIIDTVAATHSLGPILELLKVNGKLVLVGAPEKPVELPSFPLIFGKRTVS
GSMTGGMKETQEMMDICGEHNITCDIEIVSTDRINDALARLARNDVRYRFVINVGGDSKL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaggtcacccccaaccacacgcagaccgtctccggctgggccgccatggacgagtcc
ggcaagatcgtgcccttcgtcttcaagagaagggagaacggggtggacgacgtgacgatc
aaggtgaagtactgcgggatgtgccacacggacctgcacttcatccacaacgactggggg
atcaccatgtacccggtggtgccggggcacgagatcaccggcgtggtgaccaaggtgggc
accaacgtggccgggttcaaggtgggcgaccgcgtgggcgtggggtgcatcgcggcgtcg
tgcctcgactgcgagcactgccggcggtcggaggagaactactgcgacaaggtggcgctc
acctacaacggcatcttctgggacggcagcatcacctacggcggctactccggcatgctg
gtggcgcacaagcggttcgtcgtgcggatcccggacaccctcccgctggacgccgcggcg
ccgctgctgtgcgcgggcatcacggtgtacagccccatgaagcagcacggcatgctgcag
gccgacgcggccggccggcggctcggcgtggtcggcctcggcggcctcggccacgtcgcc
gtcaagttcggcaaggcgttcggcctccacgtcaccgtcatcagcacgtctccggccaag
gagcgcgaggccagggagaacctcaaggccgacaacttcgtcgtcagcaccgaccagaag
cagatgcaggctatgacgaggagccttgactacatcattgacacggtcgcggcgacgcac
tctctgggtccgatcctggagctgctcaaggtcaacggcaagctggtgctcgtgggcgcg
ccggagaagcccgtcgagctcccttccttccctctcatcttcggtaagaggacggtgagt
gggagcatgacgggtgggatgaaggagacgcaggagatgatggacatttgcggggagcac
aacatcacctgcgacatcgagatcgtgtccacggacaggatcaacgatgcgctcgccagg
ttggcgcgcaacgacgtccgctaccgcttcgtcatcaacgttgggggcgactccaagctc
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348242
Entry
4348242           CDS       T01015                                 
Name
(RefSeq) probable cinnamyl alcohol dehydrogenase 1
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4348242
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     4348242
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C
Other DBs
NCBI-GeneID: 4348242
NCBI-ProteinID: XP_015612798
UniProt: Q8H859
LinkDB
Position
10:6540759..6544161
AA seq 354 aa
MAAECGSGNCDAWAARDPSGILSPYKFNRRAVQSDDVSLRITHCGVCYADVAWTRNILNN
SMYPLVPGHEIAGVVTEVGADVKSFKVGDHVGVGTYVNSCRDCENCNSSLENYCSQHVFT
FNGVDTDGTVTKGGYSTHIVVHERYCFKIPDGYPLEKAAPLLCAGITVYSPMMRHNMNQP
GKSLGVIGLGGLGHMAVKFGKAFGLKVTVISTSESKRKEAIDLLGADNFVVSSDENQMET
LKSSLNFIIDTASGDHPFDPYLTLLKVGGVMALLSFPSEIKVHPANLNLGGRSLSGSVTG
GTKDIQEMINFCAANKIYPDIEMIKIDYINEALQRLVDRDVRFRFVIDIENSFK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggctgctgaatgtggaagtggcaactgtgatgcttgggcagcgagagatccttcaggg
atcctctccccgtacaagttcaaccgcagggctgtacaaagtgacgatgtttccttgagg
atcacacactgtggtgtttgttatgctgatgttgcatggacaaggaatatactcaacaat
tcgatgtaccctttagtccctgggcatgagatagcaggagttgtaactgaggttggtgca
gacgtcaagagcttcaaagtgggtgaccatgtaggtgttggcacatacgtgaattcatgc
cgggactgtgagaactgcaatagctctctagagaactactgctcacaacatgtcttcact
ttcaatggtgttgacactgatgggactgtcacaaagggaggatattctactcacatagta
gtacatgagaggtattgctttaaaatacctgatggctaccctttggaaaaggcagcacct
ttactttgtgctggcatcactgtatatagtccgatgatgcggcataatatgaaccagcca
gggaagtcactcggcgtcattggacttggtggcttgggtcacatggcagtaaaatttggg
aaagcctttggactgaaagtcacagttattagtactagtgaatcaaagagaaaagaagct
attgaccttcttggtgcagataatttcgtggtgtcatcggatgaaaatcagatggagacc
ttgaaaagctctctgaacttcattattgacacagcctccggcgatcacccattcgatcct
tatctcacgcttctgaaagttggtggtgtaatggcactacttagcttcccaagtgaaatc
aaagtgcatcctgcaaaccttaatctcggtgggcggagtttatctggtagtgtaactgga
ggtacgaaggacatccaggagatgataaacttctgtgcggcaaacaaaatctacccagat
atcgagatgatcaagatagattacatcaacgaggctcttcagaggcttgttgaccgggat
gtcagatttcgctttgtaatcgacattgagaactcgttcaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348690
Entry
4348690           CDS       T01015                                 
Name
(RefSeq) probable cinnamyl alcohol dehydrogenase 3
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4348690
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     4348690
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 Glu_dehyd_C 3HCDH_N NAD_binding_2 NAD_binding_7
Other DBs
NCBI-GeneID: 4348690
NCBI-ProteinID: XP_015613064
UniProt: Q337Y2
LinkDB
Position
10:complement(15303918..15309297)
AA seq 366 aa
MAPTAASAAAGEEQQAVGLAARDSSGHLSPFAISRRSTGDDDVAIKILFCGICHSDLHCI
KNEWKHSIYPLVPGHEIAGVVTEVGKNVTRFKAGDRVGVGCMVNSCRSCESCNNGFENHC
PEGVFTYNSVDKDGTVTYGGYSSMVVVHERFVVMFPEAMPLDVGAPLLCAGITVYTPMKY
HGLNAPGKHVGVLGLGGLGHVAVKFARAFGLKVTVISSSPGKKREALERLGADAFVVSSS
AEEMEAARSTMDGVINTVSANTPMAPYLALLKPNGKMILVGLPENPLEVPPFSLVHGNRT
LAGSNIGGMADTQEMIELAAKHGVTADIEVIGADDVNTAMERLAKADVRYRFVIDVGNTL
HAAAAE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggctcccacggcggcgtcggcggcggcgggggaggagcagcaggcggtggggctggcg
gcgcgcgactcctccggccacctctcccctttcgccatctcccggaggagcactggagat
gacgatgtggcgataaagattctgttctgtggaatctgccactctgacctgcactgcatc
aagaatgagtggaagcactccatctacccacttgttcctgggcacgagatcgccggtgtg
gtgacggaggtggggaagaacgtcaccaggttcaaggccggcgacagggtcggcgtgggg
tgcatggtgaactcgtgccggtcatgcgagagctgtaacaatggcttcgagaaccactgc
ccggagggcgtcttcacctacaactccgtcgacaaggacggcaccgtcacctacggcggt
tactcgagcatggtggtggtgcacgagcgcttcgtggtcatgttcccggaggcgatgccg
ctcgacgtcggcgccccgctgctgtgcgccggcatcaccgtgtacacccccatgaagtac
cacggcctgaacgcgccggggaagcacgtcggcgtgctcggcctgggcgggctcggccac
gtcgcggtgaagttcgccagggcgttcgggttgaaggtgacggtgatcagctcgtcgccg
gggaagaagcgggaggcgctggagcggctcggcgccgacgcgttcgtcgtgagcagcagc
gccgaggagatggaggccgcgaggtccaccatggacggcgtcatcaacacggtctccgcc
aacacccccatggcgccgtacctggcgttgctgaagcccaacgggaagatgatcctcgtc
ggcctcccggagaatcccctggaggtccctcccttctctctcgtccacgggaacaggact
ctggcagggagcaacatcggcggcatggcggacacgcaggagatgatcgagctggcggcg
aagcacggcgtgacggcggacatcgaggtgatcggcgccgacgacgtgaacacggccatg
gagcgcctcgccaaggcggatgtcaggtatcgcttcgtcatcgacgtcgggaacaccctc
cacgccgccgccgccgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350952
Entry
4350952           CDS       T01015                                 
Name
(RefSeq) putative cinnamyl alcohol dehydrogenase 4 isoform X1
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    4350952
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     4350952
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C ADH_zinc_N_2 AlaDh_PNT_C NAD_binding_2
Other DBs
NCBI-GeneID: 4350952
NCBI-ProteinID: XP_015615800
LinkDB
Position
11:24299635..24308007
AA seq 362 aa
MHLHGMSDMAAECGSGNCDAWAARDPSGILSPYKFNRREVQSEDVSLRITHCGVCYADVI
WTRNMFNDSIYPLVPGHEIAGVVTEVGADVKGFKVGDHVGVGVYVNSCQDCENCNSSLEN
HCSKCVVTYNSVDSDGTVTKGGYSSHILVHQRYCFKIPADYPLSKAAPLLCAGITVYTPM
IRHNMNQPGKSLGVIGLGGLGHMAVKFGKAFGLKVTVFSTSESKREEAINLLGADNFVIS
SDENQMESLKSSLHFIIDTASGDHQFDPYLSLLKVGGVMVLLSFPSEIKVHPENLNLAAR
SLAGSVTGGTKDIQEMINFCAANNVYPDIEMIKIDYVNEALQRLINRDVRFRFVIDIENS
FK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcatttgcatggtatgagtgacatggctgctgaatgtgggagtggcaactgtgatgct
tgggcagcgagagatccttccggaatcctctccccgtacaaattcaaccgcagggaagta
cagagtgaagatgtttctttgaggatcacacactgtggagtatgttatgctgatgtcatt
tggacacggaatatgttcaacgattcgatataccctttggttcctgggcacgagatagct
ggagttgtaactgaggttggtgcagacgtcaaggggttcaaagtgggcgaccatgtaggt
gttggcgtatatgtgaattcatgtcaggactgcgagaactgcaatagctctctggagaac
cactgctcgaaatgtgtcgtcacttacaacagtgttgattcagacgggaccgtaacaaag
ggtggatattccagtcatatactagtgcatcaaaggtactgctttaaaatacctgctgac
taccctttgtcaaaggcagcaccactgctttgtgcgggaattaccgtatatactccaatg
atacgacataacatgaaccaaccagggaagtcacttggcgtcattggactaggtgggttg
ggtcacatggcagtaaaatttgggaaagcctttggactcaaagtgacagtttttagtaca
agtgaatcaaagagagaagaagctatcaaccttcttggtgcagataattttgtgatatca
tcagatgaaaatcagatggagtcactgaaaagttcccttcacttcattattgatactgca
tctggtgatcaccagttcgatccttatctctcgcttctgaaagttggtggtgtaatggtg
ctacttagcttcccaagtgaaatcaaagttcatcctgaaaaccttaatctcgctgcgcgg
agcttagctggtagtgtaacagggggtacaaaggatatccaggagatgataaacttctgt
gctgcaaacaatgtttacccagatatagagatgatcaagatagactacgtcaacgaggct
cttcagaggctcatcaaccgggatgtgagattccgctttgtaatcgacatcgagaactct
ttcaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267509
Entry
9267509           CDS       T01015                                 
Name
(RefSeq) putative cinnamyl alcohol dehydrogenase 5
  KO
K00083  cinnamyl-alcohol dehydrogenase [EC:1.1.1.195]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    9267509
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.195  cinnamyl-alcohol dehydrogenase
     9267509
SSDB
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C AlaDh_PNT_C Glu_dehyd_C DUF6666 3HCDH_N ADH_zinc_N_2
Other DBs
NCBI-GeneID: 9267509
NCBI-ProteinID: XP_015649416
LinkDB
Position
8:complement(10354984..10358569)
AA seq 302 aa
MAPTAAAGLAARDASGHLSPLTISRRSTGDDDVVIKILYCGICHSDLHSIKNEWKNATYP
LVPGHEIAGVVTEAGKNVTKFKGGDKVGVGCMVNSCHSCDSCNQGLENHCPGVIFTYNSV
DKDGTVTYGGYSSMVVVHERFVVRFPEAMPLDKGAPLLCAGITVYSPMKYHGLNVPSKHV
GVLGLGGLGHVAVKFAKAFGMTVTVISSSPGKRQEALERLGADAFVVSKNADEMNAATGT
MDGIINTVSANIPIAPLLGLLKPNGKMILVGLPEKPMEIPPFALVASNKTLAGSCIGGMA
DT
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctcccacggcggcggcggggctggcagcgcgcgacgcgtccggccacctctccccg
ctcaccatctcccgcaggagcactggagatgatgatgtggtgataaagattctttactgt
gggatctgccactccgacctgcacagcatcaagaacgagtggaagaacgccacctaccca
cttgttcctgggcacgagatcgccggcgtggtgacggaggccggcaagaacgtgaccaag
ttcaagggcggcgacaaggtgggcgtcgggtgcatggtgaactcgtgccactcctgcgac
agctgcaaccaggggttggagaaccactgcccaggcgtgatcttcacctacaactccgtc
gacaaggacggcaccgtcacctacggcggctactcgagcatggtggtggtgcacgagcgc
ttcgtggtcaggttcccggaggccatgccgctggacaagggcgcgccgctgctctgcgcc
ggcatcaccgtgtacagccccatgaagtaccacggcctgaacgtccccagcaagcacgtc
ggcgtgcttggcctcggcgggctcggccacgtcgcggtgaagttcgccaaggcgttcggg
atgacggtgacggtgatcagctcgtcgccggggaagaggcaggaggcgctggagcggctc
ggcgccgacgcgttcgtcgtctccaagaatgccgacgagatgaatgccgcgacgggcacc
atggacggcatcatcaacacggtgtctgccaacattccgatcgcgccgctgctgggtctg
ctgaagcccaacgggaagatgatcctcgtcggcctgccggagaagcccatggagatccct
cccttcgctctggttgcttcgaacaagacgctggccgggagctgcatcggcggcatggcg
gacacgtag

DBGET integrated database retrieval system