KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328595
Entry
4328595           CDS       T01015                                 
Name
(RefSeq) brefeldin A-inhibited guanine nucleotide-exchange protein 1
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328595
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328595
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4328595
SSDB
Motif
Pfam: Sec7 Sec7_N DUF1981 BIG2_C DCB Mon2_C
Other DBs
NCBI-GeneID: 4328595
NCBI-ProteinID: XP_015625316
UniProt: Q7F8R6
LinkDB
Position
2:complement(5220249..5228632)
AA seq 1687 aa
MASPAGAIGGASPSGRVLGPALDRIIKNAAWRKHSGLVAAAKAALDLLSSSAYASASAPS
PPSLLLGLPAAAADACIHALLLALESASPKVADPALDCVAKLLYHRLLVGDLGGGGGDDD
SPSSKLLAAVLSCGALADDAMELSTLRVLVAAARCPSVAIRGEGLGQMLKTCYNIYLSSS
SGANQLCAKLALAQVLVIVFARVEVDSMDVRVRTVSITDMMDMSDRNLNDSSIVHAAQSF
INETMEGSDVPEPGSPVEPAETDGKEDVVMSKIREDGLTLFKNLCKLSMKFSTPDNPEDQ
VLLRGKVLSLELLKMVIDNAGAFWRTNEKYLGAIKQYLCLSLLKNSALSAMSIYQLLCSI
FLGLLSRFRSGLKEEIGIFFPMLVLRVLENVHQPSFLQKMTVLNLLEKICKDSQVIIDVF
VNYDCDVDAPNIFERIVNGLLKTALGVPPGSATTLTPAQDQTFRIESVKCLATIIKSMGS
WMDQQLKIGEFSPKPSEISLNSIDIPNILVGEDGGAVDYELQTDSGNPDLSDASSLEQRR
TYKIELQKGISLFNRKPSKGIDFLIKSKKIGHSPEDVASFLRDTAGLNATMIGDYLGERD
EFPIKVMHAYADALNFEGMDFGEAIRYYLRGFRLPGEAQKIDRIMEKFAERYCKCNPNSF
TSADTAYVLAYSVIMLNTDAHNTMVKDKMSKSDFIRNNRGIDDGKDLPEHYLSTLYDQIV
KNEIKMSADSSVPQSKQPSSVIKLLGLDNIINLVNWKQAEDKALGANDLLIKNIQEKFKA
KSGKSESIFHVITDSTILRFMMEVCWAPMMAAFSVTLDQSDDKAATSQCLQGFRSAVHVT
AVMCMQTQRDAFVTSVAKFTYLHCAADMKQKNVDAVKAIISIAIEDGDYLQDSWEHVLTC
LSRFEHLHLLGEGAPTDASFLTVPLVESEDKTQKSSSTTASKRTNALQNPAVMAAVRGGS
YDSTTAKNNASPLVTPEQINSFISNINLLDQIGIFELNHIFAHSQRLNSDAIVAFVKALC
KVSMTELHSPTEPRIFCLTKIVEIAHYNMNRIRLVWSHIWKVLSDFFVSVGSSENLSVAI
FVMDSLRQLAMKFLEREELANYNFQNEFLRPFAVVMQKSNASEVRELVVRCISQMVLSRV
NNIKSGWKSVFTVFTAAAADDRKSIVLLAFETMEKIVRDYFPYITETETTTFTDCVKCLI
TFTSSKFSSDASLNAIAFLRFCAVKLAEEGFVCHEKDTDHQSNNLDVSDGNATLHKDDHV
YFWVPLLAGLARLTTDTRPTIRKGAVEVLFDILKDHGHLFSQSFWRNIFESVVYPLFSTG
SSTPNGHINLTEDDSWNSETKTVAVKCLVDLYITFFDEMRTELSRVTSVVTNFIRSPYKQ
SASTGLSVFQRLTEGLESRLSKEEWKEILLCFKDSAMQTFVVFDKIVRMMQDIEIPDRNE
SYPEVERYSDNDIYNDDEEEANMETTSYAIIKLKNHMAQQLLVVQGIVKLYETHRWSFYA
EHMGIILETLSAIASHASEVSSESTLLMKFHKACSLLEVSEPAVIHFENESYQSYLKLLQ
ALVHDHPSISEDMKIESHIMLVSEKILRKYLKCAGRERSNDSSGRDPALRWKLPLGTAKK
EELSARTSLVLHVMQLLGGLERDCFRRNLPLFFPLLTNLIRCEHSSGEVQLALYDIFQSS
IGPIIST
NT seq 5064 nt   +upstreamnt  +downstreamnt
atggcctcgccggcgggggcaatcggcggcgcgtcgccgtcggggcgggtgctgggccct
gcgctggaccggatcatcaagaacgcggcgtggcggaagcactcgggcctcgtggcggcc
gccaaggcggcgctcgacctgctctcctcgtcggcgtacgcgtcggcgtcggcgccgtcg
ccgccgtcgctgctgctcgggttgccggcggccgccgcggacgcgtgcatccacgcgctc
ctcctcgcgctcgagtcggcgtcccccaaggtcgccgacccggcgctcgactgcgtcgcc
aagttgctctaccaccgcctcctcgtcggtgatctcggcggtggcggcggcgacgacgac
tccccgtcctccaagctgctcgccgccgtgctctcctgcggcgcgctcgccgacgacgcc
atggagctctccaccctccgcgtcctcgtggccgccgcgcggtgcccctccgtcgccatc
cgcggggaagggctcggccagatgctcaagacctgctacaacatatacctcagtagcagc
agcggcgccaaccagctctgcgctaagctggcgctggcgcaggtgctggtgatcgtgttc
gcgcgcgtggaggtggactccatggatgtgcgcgtgcgcacggtgtcgatcaccgacatg
atggacatgtctgaccgcaacctgaatgactccagcattgtccatgcggcgcagagcttc
ataaacgagacgatggagggaagcgatgtccctgagccggggtccccggttgagccggcc
gagacggatgggaaggaggatgttgtcatgagcaagatcagggaggatgggttgacactg
ttcaagaacctgtgcaagctgtccatgaagttctcgacgccggataatcccgaagatcag
gtcctgctgcgcgggaaggtgttgtctcttgagttgctcaagatggttatcgacaatgct
ggggcattctggagaacgaatgaaaagtaccttggagcaatcaagcagtatctttgtttg
tccttgttgaagaacagtgccttgtcagcaatgagtatttaccaactgttatgctccata
tttttgggtttgctgtcaagatttagatctgggctgaaagaggaaattggaatatttttt
cccatgcttgttctgagggttcttgagaatgtccatcaacctagctttctgcagaaaatg
actgtactaaaccttttggagaagatctgtaaagactcccaggttattattgatgtcttt
gtgaactatgattgtgatgttgatgcaccaaatatctttgaaaggattgtcaatgggctt
ttaaagactgctctaggggttcctcctggatctgcaacaacattaacccctgcacaagac
cagacatttcggattgagtcagtcaagtgtcttgcaaccataataaaatcaatgggttca
tggatggaccaacagctgaaaattggtgaattttcacccaaaccttctgaaatatcttta
aattcgatagacattcctaacatccttgttggagaagatgggggtgctgttgattatgaa
ctgcaaacagactctggtaacccagacctatctgacgcttcctcacttgagcagcgtcgt
acttataaaatagaacttcagaaaggaatttccttgtttaacaggaagccttccaagggt
attgattttctcattaaaagcaagaaaataggtcattccccagaagatgttgcttctttc
ttgagagatactgctggtttaaacgcaacaatgatcggggactatttgggtgaaagagat
gaattccctatcaaagtaatgcatgcatatgcagatgcactgaacttcgaaggtatggac
tttggtgaagccattaggtattacttgcgaggtttcaggttgcctggagaagcgcaaaaa
attgatcgaatcatggaaaagtttgctgaacgatactgcaaatgcaatccaaattctttt
accagtgcagatactgcatatgttcttgcttattctgtaattatgctcaataccgatgct
cataatacgatggtcaaagataagatgtcgaagtctgatttcattcgcaataaccgagga
attgatgatgggaaggatttgcctgaacattatctgagtacattgtatgatcaaattgtc
aaaaatgagataaaaatgagtgctgattcgtcagttccacaaagcaagcagcctagtagt
gtaattaagctcttaggcttggataacattatcaaccttgtcaactggaaacaggctgaa
gacaaggcacttggagcaaacgacttactcattaagaacatacaggagaaattcaaagca
aagagtgggaaatcagaatctatatttcatgttattactgattctaccattttaagattc
atgatggaggtttgttgggcccctatgatggctgcattcagtgtgacacttgaccaaagt
gatgataaggctgccacatcacagtgtttgcaaggattcagatctgcagtgcatgtaacc
gctgtaatgtgtatgcagacacagcgagatgcctttgtgacatctgttgccaaattcact
tacctccattgtgctgcggacatgaaacaaaagaatgtggatgctgtgaaggctataata
tccatcgcaattgaagatggtgactatttgcaggattcctgggagcatgtactaacatgt
ctttcacggtttgagcatctacatctccttggagagggggcacctactgatgcttcattt
ttgacagtgcctctggttgagtcagaagataaaacacagaagtcaagtagcactacagct
tcgaagcgaactaatgctcttcagaatccagctgtaatggctgccgtcagagggggttct
tacgacagcacaacagctaaaaataatgcctcaccattggttactcctgaacagataaat
agcttcatatcaaacataaatttgttagaccagattggcatttttgaattaaatcatata
tttgctcatagccagagattaaatagtgatgccattgttgcttttgtgaaagctctttgt
aaagtttcgatgacagagttgcactcacctacagaacctcgcatcttctgcctaacaaag
attgtggagattgcgcattacaatatgaaccgcatacgtctggtgtggtctcatatttgg
aaagttttatcagacttctttgtgtctgtgggatcgtcagaaaatctctcagttgcaata
tttgttatggactctttgaggcaactagcgatgaagtttctggaaagagaggaactggca
aattacaattttcagaatgaattcctgcgaccttttgcagttgttatgcagaagagcaat
gcttcggaagtacgggaacttgtcgttcgttgcatctcccaaatggttttgagtcgtgtt
aacaatataaaatccggatggaaaagtgtttttacggtttttactgctgctgctgctgat
gatcgaaaaagtattgtgctgttggcatttgaaaccatggaaaagattgttcgggactat
tttccatacataactgagactgaaaccacaacatttactgattgtgttaaatgtcttatt
acattcacgagcagtaaatttagcagtgatgccagtctcaatgctattgcatttcttcgg
ttctgtgctgttaaacttgccgaggaaggatttgtttgtcatgaaaaggatacagatcac
cagtcaaataacttagatgtttctgatgggaatgccactctgcacaaggacgatcatgtt
tatttctgggttcctctgcttgccggtctagctaggttgacaactgacacaagaccaaca
atcagaaaaggtgcagtagaggtactctttgacattttgaaggatcatgggcacctcttc
tcgcagtccttttggagaaatatctttgaatctgttgtttatcctctatttagcactggt
agctctacaccaaatgggcacattaatctaactgaggatgactcttggaattctgaaact
aaaacagtagcagtcaagtgtttagtggatttgtacattaccttttttgatgagatgcgg
acagaactttctagagttacttctgttgtcacaaactttatcagaagtccttataaacag
tctgctagcacaggtttatctgtttttcagcgtttaacagaaggacttgaaagcagactc
tccaaggaggaatggaaagagatcttgttatgttttaaagactcagcaatgcaaacattt
gtcgtgtttgacaagatagttaggatgatgcaagatatagaaattccagatagaaatgaa
tcttatcctgaagttgaacgatattcagataatgacatatacaatgatgatgaagaggaa
gctaatatggaaacaacatcatacgctattattaaattgaagaatcatatggcgcagcag
ctcttagttgttcagggcatagttaaattgtatgagacacacaggtggtctttttatgct
gagcatatgggaataattttagagacactatcagccattgcgtcacatgcaagtgaagtg
agctccgaatctaccttgctcatgaaattccataaagcatgttcccttttggaggtgtct
gagccagcagtcattcatttcgagaatgagtcttaccagagctatctcaaacttctgcaa
gctttggttcatgaccacccatcaatctcagaagatatgaaaattgagtcacatattatg
cttgtttctgagaaaatactacggaagtatctcaaatgtgcagggcgtgaacgatctaac
gattcatctggtagagatccagcattacgctggaaactgcctttgggcactgctaagaag
gaggaactgtctgctagaacttcattggtccttcatgtgatgcagttattgggtggccta
gagagggactgctttaggagaaacctgcccctgtttttccccttattaactaacctcatt
cgctgtgagcatagctctggagaagttcagcttgcactgtatgatatattccagtcatcg
ataggccctataatatcaacatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329190
Entry
4329190           CDS       T01015                                 
Name
(RefSeq) ARF guanine-nucleotide exchange factor GNOM
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4329190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4329190
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4329190
SSDB
Motif
Pfam: Sec7 Sec7_N DUF1981 RNaseH_pPIWI_RE
Other DBs
NCBI-GeneID: 4329190
NCBI-ProteinID: XP_015625789
UniProt: Q6YWF5
LinkDB
Position
2:13144821..13149918
AA seq 1424 aa
MGGLRAASPSSGAGAGAGAGSDPTPRVAMACVLASEVATVLAIMRRNVRWAGVRYGGDDG
ADDEHLDHPLIAGLKSLRRRAASWDTRQWRDVEPLLYLRPFLDVVRSDETGAPITGAALS
SLHKILTLDLVGPDAPNVAEAMGAVVEAVTGCRFEVTDPASEETVLARVLQVLLACVRGR
AAPALANRHVCNIVSTCFRVVQQAGTKGELLQRVSRQTMQEVIRCVFARLPDVDATVVAD
GQTACSKNQGLSDGEIGNGKSDFVCLNSSGDEVGGGFGVVQDQAMSELFGVPCMVEILQF
LCSLLNIAEDIEVNPRINPIDFDEDVPLFALGLISSAIELSASSINKHPELLAFVQDELF
RNLMQFGLSMSPLILSTVCSIVFTLFYHLRQELKLQLEAFFSCVIIRLGQSRYGASYQQQ
EVALEALVDFCRQKEFMAEMYANMDCDLQSSNIFEDLANLLSKSAFPVKSPLSTLNVLAL
DGLVLVIQAIAERTDNAPQHHEQTVPEISEYFPFWQLKCENTNDPDQWVRFVHQQKSIKR
KLMVGVEHFNRDKKKGFEYLQGAHLLPERLDPRSVALFFRYTPGLDKNLLGDYLGNHDEF
SILVLHEFAKTFDFKEMNLDAALRLFLETFRLPGESQKIQRILEAFSERYYEQSPQMFVN
RDAALVLSYSVIMLNTDQHNIRVKKKMTEEDFIKNNRRINGGNDLPREFLSELYYSICRN
EIRTIPEQGAGCSEMSFSRWVDLMWKSKRTSAYIACDSFPFLDHDMFTIMAGPTVAAISV
VFDNVEHEEFLTGCINGFLSVAKLAAFYHLDDVLNDLVVALCKFTTLLNTSYINDPVTTF
GEDTKARMATEAVFTIATTHGDHIRSGWRNIVDCILRLHKISLLPGCLTGDTADDQESSS
DMLPSKLASSRAAPQVVPISTPKKSYGLMGRFSQLLYLDAEESRFQPTEEQLAAQRNASE
TIKKCQIGTIFTESKFLQADSLLNLARALTQAAGRPQRITSSLDDESTSVFCLELLITVT
LNNRDRIVLLWQGVFEHITHIVQSTVMPCNLVEKAVFGLLHICQRLLPYKENLVDDLLRS
LQLILKLDARVADAYCENITQEVTRLVKGNATHIKSQMGWRTIISLLCITARHPDASDVG
FEALVFIMSEGAHLSPANFVLSVEASRQFAESRLGSAERSIHALNLMAESVNCLTRWSRE
VKEAGGEADRILEGIAEMWLRLVQALRKVCTDQREEVRNHALLSLHRCLVVDGISVPSSA
WLMSFDIIFQLLDELLEIAQNYSPKDFRNMEVSLLHAVKLLCKVFLQSLNDISSQSSFSK
LWLEVLDMIEKLMKVKVRGRRTEKLQEVIPELLKNILLVLKANRVLSKTSTSEENSLWEA
TWLQVNKIAPSLQPEVFPDSEGDVATQSAKNKSDSPAQSEGVNV
NT seq 4275 nt   +upstreamnt  +downstreamnt
atgggcggcctgagggcagcgtcgccgtcgtcgggcgcaggcgcaggcgccggggcggga
tcggatcccacgccgcgcgtggcgatggcgtgcgtgctggcgtcggaggtcgccacggtg
ctcgccatcatgcgccgcaacgtccgctgggccggcgtccgctacggcggcgacgacggc
gcggacgacgagcacctcgaccacccgctcatcgcggggctcaagtccctgcgccgccgc
gccgcctcgtgggacacgcgccagtggcgggacgtcgagccgctcctctacctccgcccc
ttcctcgacgtcgtccgctccgacgagaccggcgcgcctatcacgggcgccgcgctctcg
tccttgcacaagatactcacgctcgacctcgtcggccccgacgcgcccaacgtcgccgag
gccatgggcgccgtcgtggaggccgtcacggggtgccgcttcgaggtcactgacccggcg
tccgaggagacggtgctggctcgggtcctccaagtgcttctcgcgtgcgtgcgtggccgc
gctgcgccagctctggccaaccgccatgtctgcaacatcgtcagcacttgcttccgcgtc
gtgcagcaagccggcactaagggggagctgctgcagcgcgtctcccgccagaccatgcag
gaggttatccgctgtgtcttcgctcgcctgcctgatgttgatgccaccgtggttgccgac
gggcagactgcttgtagcaagaaccaaggtttgagtgatggagagatagggaacgggaag
agtgattttgtgtgcttgaatagctctggagatgaggtgggaggtggatttggtgttgtt
caagaccaggctatgagtgagctgtttggggttccttgcatggtagagatattgcaattc
ttgtgctcccttttgaacatagcagaagacattgaggtgaatccaaggattaatccaatt
gactttgatgaggatgtgccactatttgccctcgggttgattagttctgctattgagttg
tcagcttcatccataaacaaacaccccgaattgctggcatttgtacaagatgaactgttc
cgcaatctaatgcaatttggcttgtcaatgagccctttgattctgtcaaccgtgtgcagc
attgtttttactctcttctaccatttgcgtcaggaacttaagctacaacttgaggctttc
ttctcatgtgttatcataagacttgggcagagtagatatggtgctagttatcagcaacag
gaagttgctctggaggctctagtggatttctgtcggcagaaagagtttatggcggagatg
tatgcgaatatggattgtgatttacagtccagtaatatttttgaagaccttgctaacctt
ctgtctaaaagtgcatttcctgtgaaaagtcctttgtccaccctgaatgtgcttgctcta
gatggtttggttttggtcattcaggcaatagcagagaggactgataatgcacctcagcat
catgaacaaacagtgcctgaaataagtgaatattttcctttttggcagttgaaatgtgag
aacactaatgatcctgatcaatgggttagatttgttcaccagcaaaagagcatcaagaga
aagctaatggttggtgttgaacatttcaacagggacaaaaagaagggctttgagtacctg
caaggggctcatctcctgcctgaaagacttgatccacgcagtgtggcgttgtttttccgg
tacacacctgggttagataagaatcttcttggggactacctgggaaatcatgatgagttt
tccattctggtccttcatgagtttgctaaaacctttgacttcaaggagatgaatttggat
gctgccttaaggctcttcttggaaacttttcggctgcctggtgagtcacagaagatacaa
aggattcttgaggccttttctgagagatattatgaacaatcaccacaaatgtttgttaac
cgggatgctgctctggtgttgtcatattcagtaatcatgctcaacacagatcagcacaat
ataagggttaagaagaagatgacggaagaagactttattaagaacaatcgccgtatcaat
ggtgggaacgatcttccaagggaattcttgtcggaattgtattattctatttgtcggaat
gaaatcagaaccattccggagcaaggagctggatgctctgagatgtctttcagccggtgg
gttgatctgatgtggaagtcaaagaggacatcagcatacattgcttgtgactccttccct
tttcttgatcatgacatgtttactatcatggctggaccaacggttgctgctatctcagtg
gtttttgataatgttgagcatgaagagttccttacaggatgcattaatggttttctatca
gtggcgaagttggcggcattctatcatcttgatgatgtgttgaatgatcttgttgtggca
ctatgtaagttcaccaccttgctgaacacttcctatattaatgatcctgtaacaactttc
ggtgaggacaccaaggctagaatggcaaccgaggctgtttttactatagcaactactcat
ggtgatcacatacgcagtgggtggaggaacatagtagattgcattttaagattgcataaa
ataagcctacttcctggttgcctcaccggtgacacagctgatgatcaggagtcctcatca
gatatgttgcctagcaagcttgcctcatctcgagctgcacctcaagttgtgccaatcagc
actcctaaaaaatcatatgggctcatggggaggtttagtcagctattgtatttagatgct
gaagaatctaggttccagccaactgaggagcaacttgctgctcagaggaatgcttcagag
accataaagaagtgccaaataggtaccatcttcactgagagcaaattcttacaagctgac
tctctcttaaatctggcaagagccctcacccaggcggcaggtcgaccacaaaggatcacc
agctcacttgatgatgaaagcacatcagtcttttgcttagagcttctaattactgtcact
ttaaacaacagagacaggattgtccttttgtggcagggtgtttttgagcacataactcat
attgttcagtctacagtgatgccctgtaatctggtggagaaggctgtttttgggctgctg
cacatctgtcagcgcttgcttccttataaggagaatcttgtggatgatttactgaggtct
cttcagttaattttgaagctcgatgctcgtgtggctgatgcttattgtgagaacattacc
caggaggttacgcgcctggttaagggcaatgcaactcatataaagtcccagatgggttgg
cgaactatcatttcattactctgcatcactgctcgtcatccagatgcttctgatgttggt
tttgaagccctagtttttatcatgtctgagggagcacacctctcccctgctaactttgtc
ctttctgtggaggcctcaaggcagtttgcagagtctcggcttggctctgcagaaagatct
atccatgctttgaaccttatggcagaatcagtgaattgtcttacacgctggtcacgtgag
gttaaggaagctggtggggaggctgacaggatattggaaggaattgctgagatgtggctg
cgactagtgcaggcactacggaaggtgtgcacagaccagagggaggaagtaaggaatcat
gcgctattatcattgcacagatgcttagtagttgatgggatatcagtgccatcttcagca
tggttgatgtcatttgatattattttccagttgcttgatgaattactggagattgcacaa
aattactcaccgaaggatttcagaaacatggaggtgtccctcttgcatgctgtaaaactt
ctatgcaaagtgttcttgcagtcacttaatgacatttcatcacagagcagcttcagtaag
ctgtggttggaagtacttgacatgatagagaagcttatgaaagtcaaagtgagagggagg
aggactgagaagctacaagaggttatcccagagctactgaagaacatactgctggtgcta
aaagcaaatcgggttttatcaaagacaagcaccagtgaagagaacagtttgtgggaagca
acatggcttcaagttaacaagattgcaccttcactgcagccagaagtttttcctgacagt
gagggtgatgtagcaacacaaagtgcaaaaaacaagtcagatagtccagcacaatctgaa
ggcgtgaatgtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332241
Entry
4332241           CDS       T01015                                 
Name
(RefSeq) brefeldin A-inhibited guanine nucleotide-exchange protein 2
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4332241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4332241
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4332241
SSDB
Motif
Pfam: Sec7 Sec7_N BIG2_C DCB DUF1981 Mon2_C
Other DBs
NCBI-GeneID: 4332241
NCBI-ProteinID: XP_015630656
UniProt: Q10P53 Q0DTH9
LinkDB
Position
3:complement(7753099..7763773)
AA seq 1789 aa
MASPAAAPPPTPPESDPRLVEAFVPFLEKLIKNASWRNKAHSKLSHTAKSILDRLQNPPP
PAAAAQAPSTPTSPTTPTSSSSQPGPLRSLSLADSELLLGPINSALGSGSAKLAEAGLEL
LHRLIAHSYIHGEADPSADPSAQLVASLLDAACNALHLDDEHIELLLLKTLLSAVTSTSV
RLHGDCLLRAVRACYDMYLGSRSVVNQATAKASLVQMLVIVFRRMEADSSTVPVQPIVVA
DVIELPEAASGASPAADANFVQGFISKIIGDIDGAITPLARTTSSAAAGAGGAAAHDGAF
ETRAAEEGAHPADLLDSTDKDMLDAKYWEINMYKSALEGRKDEIGVEGAVVGALDDDADV
RIGNKLRRDAFLVFRALCKLSMKTPPKDAPADPIVMRGKILALELLKILLENAGAVFRTS
ERFLGAIKQYLCLSLLKNCASAHMIVFQLSCSIFISLVSRFRPGLKAEIGVFFPMIILRV
LENIAQPNYQAKLIVLRFLEKLCADSQILVDIFLNYDCDVHSSNIFERMVNGLLKTAQGP
PAGVSTTLVPPQDTTMKSEAMKCLVAILRSMGDWMNKQLRIPDPDSPKVESEQNDNDGGH
EISHTEDNGDECSEASDSHSEMSNGVSEAASLEQRRAYKMELQEGISLFNRKPRKGIEFL
INANKVGESPEEIAAFLKSSSGLNKTMIGDYLGEREDLSLKVMHSYVDSFDFQGMEFDEA
IRAFLQGFRLPGEAQKIDRIMEKFAERYCKCNPKAFSSADTAYVLAYSVIMLNTDAHNPM
VKNKMSPEDFIRNNRGIDDGKDLPEEFMRSLYERIWKKEIKMKEEEFVPQQQKSTSSNKI
LGLDNILNIVVRKRDSRMETSDDLIKHMQEQFKEKARMSESVFYPATDVVVLKFMVEVCW
APMLAAFSVPLDQSDDEIVISQCLEGFRSAIHVTAAMSMKTQRDAFVTSLAKFTSLHSAA
DIKQKNIEAIKAILLIADEDGNYLQEAWEHILTCVSRFENLHLVGEGAPPDATFFALQQP
DLDKSKQAKSSILPVLKKKSPNTVPASKRGSYDSAGVGGKASGVDQMNNVVTSLLEQVDM
AEMNRVFVRSQKLNSEGIIDFVKALCKVSMEELRSASDPRVFSLTKIVEIAHYNMNRIRL
VWSSIWHVLSDFFVTIGCSENLSIAIFAMDSLRQLAMKFLEREELANYNFQNEFMKPFVV
VMRKSRAVEIRELIIRCVSQMVLARVSHVKSGWKSMFMVFATASYDDHKNIVLLAFEIIE
KILREYFPYITETESTTFTDCVNCLIAFTNSRFNKDISLNAIGFLRFCAAKLAEGDIGSS
SRLKENPPSPRLTKDGKQESAVLVDKDDTIHFWFPLLAGLSELTFDLRPEIRKSALQVLF
DTLRNHGHLFSLPLWEKVFDSVLFPIFDYVRHAIDPSSGSPQGQNVESDPSELDQDAWMY
ETCTLALQLVVDLFVKFYDTVNPLLRKILLLLTSFIKRPHQSLAGIGIAAFVRLMSSAGS
VFVDEKWLEVVLSLKEAATETLPDFSYIASGAYLENVPIENGGSSEKTEDESRPLEDGTG
EASRSRNLYFAIGDAKCRAAVQLLLIQAVMEIYNMYRARLSSQNTVILFEALHTVATHAH
KINSDNDLRSKLQELGSMTQMQDPPLLRLENESYQLCLTILQNICLDRSPNERSVEVESH
LVGLCKEVLEVYLSTANPSQLSGAPQPLGHWLIPVGSSKRRELAARAPLVVSTLQAISGL
GDSSFEKNLGQFFPLLAGLISCEHGSSEVQVALSDMFSTWVGPVVLQTC
NT seq 5370 nt   +upstreamnt  +downstreamnt
atggcttccccggcggcggcgccgccgcctaccccgccggagtccgacccgcggctcgtg
gaggccttcgtgcccttcctcgagaagctcatcaaaaacgcctcgtggcgcaacaaggcg
cactccaagctctcccacactgccaagtccatcctcgaccgcctccagaacccgccgccg
ccggcggctgcggcgcaggcaccgtccacgcccacctcccccacgacgcccacctcgtcg
tcctcgcagccgggcccgctccgcagcctctcgctcgcggactcggagctgctgctcggc
ccgatcaactccgcgctcggctccggcagcgccaagctcgccgaggccgggctcgagctg
ctccacaggctgatcgcgcactcctacatccatggcgaggccgacccgtccgccgacccc
tcggcccagctcgtcgcgtccctcctcgatgccgcctgcaacgcgcttcacctcgacgac
gagcacatcgagctcctcctactcaagacgctcctctcggcggtcacctccacgtcggtg
cgcctccatggagattgcctgcttcgcgccgtgcgcgcttgctatgatatgtacctggga
agccgcagcgtggtgaaccaggccactgccaaggcgtcactcgtgcaaatgttggtgatc
gttttccgccgcatggaggcagactcctccacagtgcccgtgcaacccatcgttgtggct
gatgtgatcgagctgcctgaagctgcttctggtgcttcgcctgccgctgatgccaacttt
gtacagggattcatctcgaagatcattggagacattgatggtgcaatcacacctctggca
cggacaacttcttcagcagctgcaggcgcaggtggagcagcggctcatgatggtgcattt
gagacaagagcagcagaggaaggggcacatccagcagatttgcttgattcaacagacaag
gacatgctagacgccaagtactgggagatcaacatgtacaaatctgctcttgagggtcgt
aaggatgagattggtgtggagggggcagtggtgggcgctttggatgatgatgctgatgtg
aggattgggaataaactgcgaagagacgctttcttggttttccgggcattgtgcaagctc
tccatgaagacaccacccaaggatgctccagctgatcccattgtgatgcgtgggaagatc
cttgctcttgaacttctcaagatattgcttgaaaatgctggggctgttttccggaccagc
gagagatttctaggggctatcaagcagtatctatgcctctcgcttttgaagaactgtgcc
tcggcacatatgatagtctttcagctatcttgttcaatttttattagcttggtttcaaga
ttcagaccaggattgaaggcagaaattggagtattctttcccatgattattctgagagtt
ttggaaaatattgctcaaccaaattatcaagcaaagttgattgttcttcgtttcctggaa
aaactctgtgctgattctcaaatcttggtagacatttttctcaattatgattgtgatgta
cactcatcaaacatatttgagaggatggttaatggtctactaaaaacagcacaagggcct
ccagcaggcgtgtctaccacattggttccgcctcaggacaccacaatgaaaagtgaagcc
atgaaatgcttggttgctattctgagatccatgggagattggatgaataagcagctacgc
attccagatcctgactctcctaaagtagagtcggagcaaaatgataatgatggaggacac
gagatttcccacacagaggataatggagacgaatgtagtgaagcatctgattctcattca
gaaatgtcaaatggggtttcagaggctgcatctttggagcagcgccgagcttacaagatg
gaacttcaggagggtatctctctatttaatcgaaagcccaggaagggaattgagttccta
ataaatgccaacaaggtgggggaatcacctgaggaaattgctgctttcttaaaaagttct
tctggtttgaacaagactatgattggagattatttaggggagagggaagatttatccctc
aaagtcatgcattcatatgtggattcatttgattttcaaggcatggagtttgatgaagcc
attagagcctttcttcaaggtttcagattgcctggagaagctcaaaagattgatcggatt
atggaaaaatttgctgagcgttactgcaaatgcaacccaaaggccttttccagtgcagat
acagcttatgtccttgcttattcagtcataatgctcaacaccgatgcacataatccaatg
gtaaaaaataagatgtcaccagaagatttcattagaaacaatcgaggtattgacgatggg
aaagacctgcctgaagaatttatgaggtccttatatgaaaggatttggaaaaaagagatt
aagatgaaagaagaagaatttgttccccagcagcaaaaatcaacaagctcgaacaaaatt
cttggattggataacattcttaatattgtcgtacgcaaacgagattcacgtatggaaaca
agcgatgatctcattaagcatatgcaggagcaattcaaagaaaaggctcgtatgtccgag
tcagtattctatccagcaacagatgtagtagttttgaaattcatggtcgaggtttgctgg
gctcctatgcttgctgccttcagtgttccacttgaccagagtgatgatgagattgtcata
tcccagtgccttgaaggatttcgcagtgcaatccatgttactgcagctatgtcgatgaag
actcaaagggatgcatttgtcacttcacttgctaagtttacatcacttcactcggctgcg
gatattaagcagaaaaatattgaagccattaaggcaattctattaattgcagatgaagat
ggaaattacttgcaagaagcatgggagcatatattgacctgtgtttctcgttttgaaaat
ctacatctcgtaggagaaggtgctcctccagatgctactttctttgcactgcaacagccg
gacctcgataaatcaaaacaggctaagtcatccattcttcctgttttgaaaaagaagtct
ccaaatactgttccagcttctaaacgaggttcctatgatagtgctggtgtgggtggcaaa
gcttctggggttgatcaaatgaacaatgtggtgacaagcctcttagaacaagttgacatg
gctgaaatgaatcgtgtatttgtaagaagtcaaaaactcaacagtgagggcataattgat
tttgtaaaggctctctgtaaagtttccatggaggaattgcgatctgcttctgatccacgg
gtttttagtctgacaaagattgttgagattgcgcactacaatatgaatcgcatcaggctt
gtctggtcaagcatatggcatgtcttgtctgatttttttgttacaattggctgctcagag
aatctctcaattgcaatatttgctatggattcattgaggcagctggcaatgaagttcctg
gaacgagaagagctggctaactacaatttccagaatgaatttatgaagccttttgttgtt
gtaatgaggaagagccgagctgttgagataagagaactaatcatcagatgtgtctctcaa
atggtcttggcacgtgttagtcatgtgaaatcagggtggaagagtatgtttatggtcttt
gcaacagcttcatatgatgaccataaaaatattgtactcctggcgtttgaaattatcgag
aagattttgcgggagtactttccctacattactgagaccgagtcgacaactttcactgat
tgtgtgaactgtcttattgcatttactaacagtaggtttaacaaggatataagcctcaat
gcaattggttttcttcgattctgtgcggcaaagctagcggaaggtgacattggatcctct
tcaaggttgaaggagaatcctccttctcctcgcttgaccaaggatggaaagcaggaaagt
gcagttcttgttgataaggatgatactatacacttttggtttcctttattagcaggatta
tctgaacttaccttcgacctacgacctgaaatcaggaaaagtgccttgcaggtgttattt
gacacattaagaaaccatggtcatctcttctccttgcctttgtgggagaaggtgtttgat
tcagtgcttttcccaatatttgattacgtacggcatgccattgatccatcaagtggttct
ccacaaggacagaatgtggaaagtgatccttcagaacttgatcaagatgcatggatgtac
gagacatgcactttggccctgcagctagttgtggacctctttgttaagttctatgacaca
gtaaaccctcttcttagaaaaattctgttgctcttgacaagtttcataaagcgtccccac
cagagccttgccggtataggtattgccgcatttgttcgtttgatgagcagtgccggatct
gtcttcgttgatgaaaaatggttagaggtggttttatcgttgaaagaagctgccactgag
acccttcctgatttttcttatattgcatccggagcttaccttgagaatgtaccaatagaa
aatgggggctcttcagaaaagacagaagacgagtctcgaccattggaggatggcactgga
gaagcttctagatcaaggaacttgtattttgcaattggtgatgccaagtgccgggctgct
gtccaactcctattgattcaggctgtgatggagatatataacatgtacagagctcggtta
tcatcacagaacactgtgatcctctttgaggcattgcacactgttgctactcatgctcat
aaaataaacagtgataatgacctgcgatccaagttgcaggagttgggctcgatgacccaa
atgcaggacccacctttgttacgcctggagaacgagtcgtatcagttgtgcttgactatc
ctgcagaacatttgcttggacagatctcccaatgagaggagtgtagaggtggaaagccac
cttgttggcttatgtaaggaggtccttgaggtgtacctgagcactgcaaacccatctcag
ctttctggtgctccgcagccacttggtcattggcttattccggtcggttcttcaaagcgg
agagagcttgcagcccgggcacctcttgttgtctcaaccttgcaagctatcagtggcctt
ggtgactcatctttcgagaagaaccttggccagttcttcccccttcttgctggtctgata
agttgcgaacatggttcaagcgaagtgcaggtggcattgagtgatatgtttagcacttgg
gttggcccggttgttcttcaaacctgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334954
Entry
4334954           CDS       T01015                                 
Name
(RefSeq) ARF guanine-nucleotide exchange factor GNL2
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4334954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4334954
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4334954
SSDB
Motif
Pfam: Sec7 Sec7_N
Other DBs
NCBI-GeneID: 4334954
NCBI-ProteinID: XP_015635165
UniProt: Q7XT11
LinkDB
Position
4:complement(1021564..1026382)
AA seq 1407 aa
MARTAAAAVSDDDDDGPPAYTVPRGPRRDPRLKDLGISCMLNTEVAALLAVIRRRPDPYS
YLPPAVAAAEEATFAGLIQSLKNLRGLLFQPRHGAWRCSDPAMYLKPFLDVVQSEESPPA
ATGVALSSVLKILRIDVFDECSPGARDAIQAVLTAVSSCRVERIADPGAEEAVLLRVLQV
LAALLRARAAPLLSDHAVCNAVNTCFQVVQHAASGRGSELLQRTARHCMHEILQAVFARL
PDIPAADAADADDLSVAGFGARCMADIFNFLCTLLLNAPDMVATGDGHGAFITEEDVQLF
SLVLINSAIELGGEAIGKHPKLLRLIQDDLFYHLIHYATESSPLVLSMICSTALNLYHFL
RRFLKLQLEAFFMYVLLRLCGGGGGAQLQEVAIEGLISFCRQPTFVIEMYVNYDCDPMLR
NVYEEVGKLLCKAAFPASSPMTTVQLQAFEGLVNMLTTIADNVEVDKAPDHAAYAVDISD
YRLFWVERWDAAAAGGSGNNETWVDFVRKRKLRKKKVAIAANHYNRDEKKGMEYLRLSQL
VPTPPEPRSMAFFLRYSPGLDKNKIGELLGDPEEQSLRVLKEFTETFDFTGVILDTALRT
YLETFRLPGESQKIQRILEAFSERFYEQQTAEVFATKDAAFILCYSLIMLNTDLHNPQVK
KKMSEDDFIRNNRAINAGKDLPREYLSELFHSISGNAITVFSQASAAAEMTPTRWADLVK
RSRAIDPFTPCDFKHKLTREVFVTVSGPAVATLAAIFDYTDDEDILNQCVEGLISVARIA
RYGLEDVLDELLCCLCKFTTLLNPYATTEETLFTFSNELKPRMATLALFTITNRFGESVR
GAWKNVVDCLLKLKRLKLLPPSLVDQEGGAGAAVSTERLGHRAKSESGVIFPSSHRGAGT
SRHVSGMIGRFSQFLSLDAGGESLLSVGSEFENNLKIIQQCRIGSIFTESGKLPDESVQN
LGRALIFAAGGKGQKFSTPVEEEETVGFCWDLIAVVSSANVHRFTTFWPQLHDCFAAVSQ
LPLFSPCPFAEKAIVALFRVAVRLLSGGGGDRMAEELVFKSINLMWKLDKEILDTCCEGI
SECIVKLLMEYASNVQTPIGWKTVLHLLSVTGRHPETFDQSVAAMIKLMNDGAQVVTRFN
YAACIEAAFGFAALKISPLDISTRILQLMADSVNWLILWHKSGYSDPGNAWSSSSSSSSA
AAMMMMEDASRMGNLATSMFIKLAEALRKTSLVRREEIRNQAVAELGRAFALAAAGELEL
GPTGSLACFNLVIFAMVDDLHEKTLEYSRREGAERETRSMEGTLAAATELLADVFVLFLG
TLAQGAGFRTFWLGVLRRLDTCIKSDLAAGGGAGVMQELVPRMLKRMIVEMKDKGVLVAM
EGDELWEITHIQIQWIAPAVMEELFPD
NT seq 4224 nt   +upstreamnt  +downstreamnt
atggcgaggacggcggcggcggcggtctccgacgacgacgacgatggcccgccggcgtac
accgtgccacggggcccccgccgtgaccccaggctcaaggacctcggcatctcctgcatg
ctcaacaccgaggtggccgcgctcctcgccgtcatccgccgccgcccggacccctactcc
tacctcccgccggcggtcgccgccgcggaggaggcgacgttcgccgggctcatccagtcg
ctgaagaacctgcgggggctcctcttccagccccggcacggtgcctggcgctgctccgac
ccggccatgtacctgaagccgttcctcgacgtggtccagagcgaggagtcgccgccggcg
gccaccggcgtggcgctgtcgtcggtgctcaagatcctgaggatcgacgtgttcgacgag
tgctccccgggcgcccgcgacgcgatccaggcggtgctgacggcggtgagcagctgccgc
gtggagcgcatcgccgacccgggcgccgaggaggccgtcctcctccgcgtgctgcaggtg
ctcgccgcgctgctccgcgcccgcgccgcgccgctcctctccgaccacgccgtctgcaac
gccgtcaacacctgcttccaggtggtgcagcacgccgccagcggccgcggcagcgagctc
ctccagcgcacggcgaggcactgcatgcacgagatcctccaggccgtcttcgcccgcctg
cccgacatcccggccgccgacgccgccgacgccgacgacctgtccgtggccggcttcggc
gcgcgctgcatggccgacatcttcaacttcctctgcacgctgctgctcaacgcccccgac
atggtggccaccggggacggccacggcgcgttcatcaccgaggaggacgtgcagctcttc
tccctcgtcctcatcaactccgccatcgagctcggcggcgaggccatcggcaagcacccc
aagcttctccgcctcatccaggacgacctcttctaccacctcatccactacgccactgag
tccagccctctcgtcctctccatgatctgcagcacggctctcaacctctaccacttcttg
cgccggttcctgaagctgcagctcgaggcgttcttcatgtacgtgctgctccggctgtgc
ggcggcggaggcggggcgcagctccaggaggtggcgatcgaggggctgatcagcttctgc
cggcagccgacgttcgtgatcgagatgtacgtgaactacgactgcgacccgatgctgcgg
aacgtgtacgaggaggtggggaagctgctgtgcaaggcggcgttcccggcgtcgagcccc
atgacgacggtgcagctccaggcgttcgagggcctcgtcaacatgctcaccaccatcgcc
gacaacgtcgaggtcgacaaggcccccgaccacgccgcctacgccgtcgacatctccgac
taccgcctcttctgggtggagcgctgggacgccgccgccgccggcggctccggcaacaac
gagacgtgggtggacttcgtccgcaagcggaagctgaggaagaagaaggtggcgatcgcg
gcgaaccactacaaccgcgacgagaagaaggggatggagtacctccggctgagccagctg
gtgcccaccccgccggagccccggagcatggccttcttcctccgctactcgccggggctg
gacaagaacaagatcggcgagctcctgggcgacccggaggagcagagcctgagggtgctc
aaggagttcacggagacgttcgacttcaccggcgtgatcctggacacggcgctgcgcacc
tacctggagacgttccgcctccccggcgagtcgcagaagatacagcggatcctggaggcg
ttctcggagaggttctacgagcagcagacggcggaggtgttcgccaccaaggacgccgcc
ttcatcctctgctactccctcatcatgctcaacaccgatctccacaacccacaagtgaag
aaaaagatgtcggaggacgacttcatccgcaacaaccgtgccatcaacgccggcaaggac
ctccccagggagtacctctccgagctcttccactccatctccggcaacgccatcaccgtc
ttcagccaggcctccgccgccgccgagatgacgcccaccagatgggccgacctcgtcaag
cgctcccgcgccatcgaccccttcaccccctgcgacttcaagcacaagctcacccgcgag
gtgttcgtcaccgtctccggccccgccgtcgccaccctcgccgccatcttcgactacacc
gacgacgaggacatcctcaaccagtgcgtcgagggcctcatctccgtcgcccggatcgcg
cgctacggcctcgaggacgtcctcgacgagctcctctgctgcctctgcaagttcaccacg
ctgctcaacccctacgccaccaccgaggagacgctcttcaccttcagcaatgagctcaag
cccaggatggccacgctcgcgctcttcaccatcaccaaccgcttcggcgagtcggtgcgc
ggcgcgtggaagaacgtcgtcgactgcctgctcaagctcaagcgcctcaagctgctgccg
ccgtcgctggtcgaccaggagggcggcgccggcgccgccgtgagcacggagcggctggga
caccgggccaagtcggagtccggcgtcatcttcccgtcgtcgcaccgtggcgccgggacg
agcaggcacgtgtccggcatgatcgggcggttctcgcagttcctgtcgctggacgccggc
ggcgagtcgctgctgtcggtggggagcgagttcgagaacaacctcaagatcatccagcaa
tgccggatcgggagcatcttcacggagagcgggaagctgccggacgagtcggtgcagaac
ctggggcgggcgctcatcttcgccgccggcggcaaggggcagaagttcagcacgccggtg
gaggaggaggagacggtgggcttctgctgggacctcatcgcggtcgtctcgtcggcgaac
gtgcaccgcttcaccacgttctggccgcagctgcacgactgcttcgccgccgtgtcccag
ctgccgctcttctcgccgtgcccgttcgccgagaaggcgatcgtggcgctgttcagggtc
gccgtgaggctgctctccggcggcggcggggaccggatggcggaggagctggtgttcaag
tcgatcaacctgatgtggaagctggacaaggagatcctggacacctgctgcgaaggcatc
tcggagtgcatcgtgaagctgctgatggagtacgccagcaacgtgcagacgccgatcggg
tggaagacggtgcttcacctgctgtccgtcaccgggcggcacccggagacgttcgaccag
tcggtggccgccatgatcaagctcatgaacgacggcgcgcaggtggtgacgcggttcaac
tacgcggcgtgcatcgaggccgccttcgggttcgcggcgctcaagatcagcccgctcgac
atcagcaccaggatcctccagctcatggccgactccgtcaactggctcattttatggcac
aagtccggctactccgacccgggcaacgcctggagcagctcaagctcgtcgtcgtcggcg
gcggcgatgatgatgatggaggacgcgtcgcggatgggcaacctggcgacgagcatgttc
atcaagctcgcggaggcgctgcgcaagacgagcctagtccggcgagaggagatacggaac
caggcggtggcggagctgggccgagcgttcgccctggccgccgccggcgagctcgagctg
ggcccgacggggtcgctggcgtgcttcaacctggtcatcttcgccatggtggacgacctg
cacgagaagacgctggagtactcgaggagggagggggcggagagggagacccggagcatg
gaggggacgctggcggcggcgacggagctgctcgccgacgtgttcgtgctgttcctgggg
acgctggcgcagggggcggggttcaggacgttctggctgggggtgctccggcggctggac
acgtgcatcaagtcggacctggcggcgggcggcggcgccggcgtgatgcaggagctggtg
ccgaggatgctgaagcggatgatcgtggagatgaaggacaagggggtgctggtcgccatg
gaaggagacgagctgtgggagatcacccacatccagatccagtggatcgctccagctgtc
atggaggagctcttccctgattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341555
Entry
4341555           CDS       T01015                                 
Name
(RefSeq) brefeldin A-inhibited guanine nucleotide-exchange protein 1
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4341555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4341555
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    4341555
SSDB
Motif
Pfam: Sec7 Sec7_N DUF1981 BIG2_C DCB Mon2_C
Other DBs
NCBI-GeneID: 4341555
NCBI-ProteinID: XP_015643267
UniProt: Q69XU9
LinkDB
Position
6:25046025..25055165
AA seq 1693 aa
MSSPAAGEADAAARVLARALDKVIKHSSWRKHSALVAASKSALDLLSASPDVDEAASASA
SPIQGVAAAAADAAIRALLIALDPASPKVAEPALECVSTLLSLRLLHGEVVAVAAAGAAD
ADDAASPVSKLFAAVVSCGGLGDEGLELAALRVLVAFARCPSVSVSGDCLGHVVRACYNL
YLGSASGGNQLCAKLALAQVLAIVFARVEADAMDVRVRTVSAADMMDLSDRSLNDSSVVQ
AAQAFINEAMEGSDVPEEVPPSDLPAEADENGDDVGMSRIREDGLALFKNLCKLSMKFAT
PDNPDDPVLLRGKVLSLELLRTVVDNAGPFWKSNEMYLEAIKKHLFLSLLKNSALSAMSV
FQLLCSIFVGLLSRFRSGLKEEIGLFFPMLILRVLENVLQPSFLQKMTVLNFLEKICKEP
QVIIDIFVNYDCDVDAPNIFERIVNGLVKTALGVPAGSTTTLTVAQDQTFRIESVKCLAV
IVKSMCSWMDRQLRIGEFSLISSETPGSMDNHTTNGDGSGMDYDMQPDTSSSDISDSSSL
EQRRAYKIELQKGIALFNRKPSKGIDFLVRSKKIGHSPEDVALFLKNTAGLNATMVGDYL
GERDDFPLKVMHAYVDALNFKGMDFGEAIRFFLQGFRLPGEAQKIDRIMEKFAERYCKCN
PNAFTSADTAYILAYSVILLNTDAHSVMVKDKMSKADFMRNNRGIDDGKDLPEDYLSALY
DQIVNKEIKMSADSSTTQIKQPNSISKLLGLDNIINFVNWGQAEDKALGANDLLIKHIQE
KFKAKCRKSESVFYTVSDATILRFMMEACWAPMMAAFSVTLDQSDDKASAAQCLKGLRFA
VHITSVMCMQTQRDAFLTTIAKFTSLHSAADMKQKNVDAMKAIISIAIEDGNYLQEAWEH
VLTCLSRFEHLHLLGEGVPTDSSFLTVPLVESEQKNHKSSSGLSSKRTNALQNPAVMAAV
RGGSYDSTVAKTSASSLVTPEQISNFISNLNLLDQIGIVELNHIFTHSQRLNSDAIVAFV
KALCKVSMTELQSPTDPRIFCLTKIVEIAHYNVNRIRLVWSRIWKVLSEFFVSVGLLENL
SVAIFVMDSLRQLAMKFLEREELANYNFQNEFLRPFVIVMQKSNAPEVRELIVRCVSQMV
LSRVNNIKSGWKGVFMVFTSAAADDTKSIVLLAFETMEKIVRDYFPYITETENTTFTDCV
NCLIAFTSSQFNSDANLNAIAFLRFCAVKLADEGFGCQEKCTDEPRNLGMSDGNATVDKD
DSISLWIPLLAGLAKLTSDSRSTIKRSAVGVLFDILKDHGQLFSESFWTNILESVIYPLF
SSERSSSNDPTSTPSIPEDDFSNLETQTLAVKCLVGLFINFFDVMRPELARVASIVTYFI
RSPYKHSASIGVSALMRLIEGVGGELSKEEWKDILLRFKESVAHTFLVFSKIVRMMQDIE
IPDRFESYSENDQYSDHENYGNEEEEANMETTSYAIVKLKNHMALLLLVVQGIIKLYEEH
RKYLSSDHINILLEMISAIATHASEVSSESSLLLKFHKACSLMEVSEPAIVHFENESYQT
YLKLLQALFRDYPSMSEEMDIESQILRVCEKILRIYLQCAQREPSNEALHRNASIHCIVP
LGAAKKEELAARTSLVLLVMQLLGNLEEDSFRRVLPWFFPLLVDLIRCEHSSGEVQHALY
KIFQSSIGPMLTV
NT seq 5082 nt   +upstreamnt  +downstreamnt
atgtcgtcgccggctgcgggcgaggccgacgccgccgcccgcgtgctcgcccgcgccctc
gacaaggtcatcaagcactcctcctggcgcaagcactccgcgctcgtcgccgcctccaag
tccgccctcgacctcctctccgcctccccggatgtcgacgaggccgcctccgcctccgct
tcccctatccagggggtcgccgcggccgccgccgacgcggcaatccgcgctctcctgatc
gcgctcgacccggcctcccccaaggtcgccgagcccgcgctggagtgcgtctccaccctc
ctctccctccgcctcctccacggcgaggtcgtagccgtcgctgccgctggcgctgctgac
gccgacgacgccgcctcgccggtatccaagctcttcgcggccgtggtctcctgcgggggg
ctcggggacgagggcctcgagctcgccgcgctccgcgtgctggtcgccttcgcgcggtgc
ccctcggtctccgtctccggggactgcctgggccacgtcgtgagggcgtgctacaaccta
tacctcggcagcgcgagcggcgggaaccagctctgcgcgaagctggcgctcgcgcaggtg
ctcgccatcgtgttcgcgcgcgtcgaggcggatgccatggacgtgcgcgtgcgcaccgtc
tccgccgccgacatgatggacctctccgatcgcagcctgaatgactccagcgtagtgcag
gcggcacaggcgttcataaacgaggcaatggaggggagcgatgtgccagaggaggttccc
ccatcggatttgccagctgaggcagatgaaaatggagatgatgtggggatgagcaggatc
agggaggatgggctggcattgttcaaaaacctttgcaagctgtcgatgaagtttgccacg
ccggataaccccgatgatccggtgctgctgcgggggaaggttttgtcacttgagctgctt
agaacagtcgttgacaatgcagggccattctggaaatcaaatgaaatgtatcttgaagcg
attaagaagcacctatttttatcattgctgaagaacagtgccttgtcagcaatgagtgtt
ttccagcttctgtgctccatttttgttggtctgctgtcaaggtttagatctggcttgaaa
gaggaaattggattattttttcctatgcttatcctaagagttcttgaaaatgtccttcag
cctagctttctgcagaaaatgacagttctaaactttttggagaaaatatgtaaagagcct
caggttatcattgatatttttgtgaactatgattgtgatgttgatgcgccaaatattttt
gaaaggattgtcaatggactagtaaagactgctttaggtgtccctgctggatcaacaaca
acattaactgttgcacaagaccaaacatttcgaattgaatctgtcaagtgccttgcagtt
attgttaagtcaatgtgttcatggatggaccgacaactgagaattggtgaattttccctg
attagttcagaaactccaggctcaatggacaatcatactaccaatggagatggaagtgga
atggattatgacatgcaacctgacacaagcagctctgacatatctgattcttcctcactt
gagcaacgacgtgcttataaaatagaacttcagaaaggaattgccttgtttaacaggaag
ccttccaaaggtatcgattttcttgtccgcagcaagaaaataggccattcgccggaagat
gtggctcttttcttgaaaaacactgctggcttaaatgcaacaatggtaggagactatttg
ggtgaaagggatgacttccccctaaaagtcatgcatgcttatgtggatgcactgaacttt
aaaggcatggacttcggtgaagcaatcaggtttttcttgcaaggtttcagattaccaggg
gaagcacagaaaattgaccggatcatggaaaaatttgctgaacgctactgtaaatgcaat
ccaaatgcttttactagtgcagatactgcctatattcttgcttactctgttatcttgcta
aacactgatgctcacagtgtcatggtgaaagataagatgtctaaggctgatttcatgcgc
aataaccgaggaattgatgatgggaaggacttacctgaagattatcttagtgcattatat
gaccaaattgtcaataaggaaattaaaatgagtgctgattcttcaacgacacaaatcaaa
caacccaatagcataagcaagcttcttggcttagacaatatcatcaattttgtcaactgg
ggacaggcagaagacaaagcattaggtgcaaatgacttgctcattaagcacatacaggag
aaatttaaagcaaaatgcaggaaatcggagtctgtgttctatactgtttctgatgcaacc
attttaagattcatgatggaggcctgttgggctcctatgatggcagcattcagtgtgaca
ctagaccaaagcgatgataaggcttctgcagcgcagtgtttaaagggattaagatttgct
gtgcatatcacatctgttatgtgcatgcagacacagagagatgcttttttgacaaccata
gccaaattcacatccctccattctgctgcagacatgaaacaaaaaaatgtcgatgctatg
aaggctattatatccatcgcaatcgaagatggcaattacttgcaggaagcatgggaacat
gtattgacttgtttgtcacggtttgagcatttgcacctgcttggagaaggggtacctact
gactcgtcgtttcttacagtacccttagttgagtccgaacaaaaaaatcataagtccagc
tctggtctatcttcaaagagaaccaatgctcttcagaatcctgctgtaatggctgctgtt
agaggaggttcttacgacagcacagtggcaaaaaccagtgcctcgtcattggttactcct
gaacagatcagtaatttcatatcgaacttaaatttgttggaccagattggtattgttgag
ttaaatcatatatttacccacagccaaagattaaacagtgatgccattgttgcttttgtg
aaagctctttgcaaggtctcaatgactgagttgcagtctccaacggatcctcgtatcttc
tgccttacaaaaatagtagaaatcgcgcattacaacgtgaaccgcatacgtttggtgtgg
tctcgaatttggaaagttctgtcagaattttttgtatctgttggactgctagaaaatctt
tctgttgcaatatttgtgatggattctctgaggcagctggcaatgaagtttctggaaaga
gaggaactggcaaactataacttccagaatgagttccttagacctttcgtgattgttatg
cagaagagtaatgctccagaagtacgagagctgattgtccggtgtgtctcacagatggtt
ctaagtcgtgtcaacaacataaaatctggctggaagggtgtttttatggtatttacttct
gctgcagctgatgatacaaaaagtattgtcctattggcatttgaaactatggaaaaaatt
gttcgagattactttccatacataactgagacggagaacaccacattcactgattgtgtt
aactgtcttattgcgtttacaagcagccaatttaatagtgatgctaatctcaatgctatt
gcgtttctccgattctgtgctgttaaacttgccgatgaaggatttggttgtcaggaaaag
tgtactgatgaacccaggaatttaggcatgtcagatggaaatgccactgtggacaaggat
gattctatttccttatggattcctctccttgcaggtttagctaaattgactagtgattca
agatcaaccatcaagagaagtgctgtgggagtactttttgacattttgaaggatcatgga
caactcttctcagagtccttttggaccaacatccttgaatctgttatttatcctctattt
agcagtgaaaggtcttcatcaaatgatccgacctcaacaccgagtatccctgaggatgac
ttttcaaatcttgaaacccaaacattggcagtgaaatgtttagtgggtttgtttattaat
ttctttgatgtgatgcgtccagaacttgctagggttgcatctatagtcacatattttatc
cgaagtccctacaaacattctgctagcataggtgtatctgctttgatgcgcttaattgag
ggagttggtggtgaactttccaaggaggaatggaaagacatattgctgcgcttcaaggaa
tcggtggcacatacttttcttgtattctccaaaattgtgagaatgatgcaagatattgaa
attcctgatagatttgaatcttattcagaaaatgatcagtactcagatcatgaaaattat
ggtaatgaagaagaggaagctaatatggagacaacttcttatgctattgtcaaactgaag
aatcatatggctctgctcctcttagttgttcagggaataattaaattatatgaagaacac
agaaaatatctgtcttccgatcatattaatattcttttggagatgatatcagctattgcg
acacatgcaagtgaagtgagctctgaatcttccttgctgctgaagtttcataaagcatgt
tcccttatggaagtatctgagccagcaattgtccatttcgaaaatgagtcataccagacc
tacctcaagcttctgcaagcgctgtttcgtgactatccatccatgtcggaagaaatggac
attgaatcacaaatacttcgtgtttgtgagaaaatacttcggatatatctacagtgtgca
cagcgagaaccatccaatgaagctttgcacagaaacgcatctatacattgcatagtgcca
ctgggtgctgctaaaaaagaggaattggctgctaggacttcattggtcctcctcgtgatg
cagttactgggaaacctggaggaggattcatttaggagagtactgccctggtttttcccg
ttgctagttgatctgatccgttgtgagcatagctctggagaagttcaacatgcactgtac
aaaatcttccaatcatcaataggccccatgctaacagtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271296
Entry
9271296           CDS       T01015                                 
Name
(RefSeq) ARF guanine-nucleotide exchange factor GNOM
  KO
K18443  golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9271296
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    9271296
Membrane trafficking [BR:osa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    9271296
SSDB
Motif
Pfam: Sec7 Sec7_N Mon2_C
Other DBs
NCBI-GeneID: 9271296
NCBI-ProteinID: XP_015630801
LinkDB
Position
3:26200827..26207684
AA seq 1410 aa
MGRPRLPGAAGIDPIAEEPPHSAAAAGDGGDAAGLACAISAEASAVLAVMRRSLRHPRAA
ADDAAADHPLVSSLKALRRLVFSPSAAAAPAGAVLRPFLDAVRSEDAGAAVTSASLAALH
EVMALMGPSLTGAALREVVDAVASCRFEAGAEAAAEEAVLMRMLQALLACLRAPAAPALG
DQHVCTAVNTCFRVVHQAGAKGELLQRFSWHAMHELIRCVFARLPQIGSGDGPDGSVKPE
MGGMDKNHPFGIGQMENGNGSYASEAVTSDENSADGSGIVVEPYGIPCMVEIFHFLCSLL
NVVEQIGVDEDLPLFALKLINSAIELGGSSIRKHPKLLSLVQDELFRNLMQFGLSMSPLI
LSMVCSIVLNLYHHLRTELKLQLEAFFSCIILRLAQPRFGATYHQQEVAMEALVDFCRQK
NFMVEMYANLDCDITCRNIFEELANLLSKSAFPINCPLSSMHILALEGLISVIQGMADRI
GNATSRPELLPVELDEYTPFWTVKCENFSDPQHWVKFVRQRKYVKRRLMIGADHFNRDPK
KGLEFLQGTHLLPEKLDPQSVACFFRYTAGLDKNLVGDFLGNHDEFCVQVLHEFAQTFDF
QEMNLDTALRLFLETFRLPGESQKIQRVLEAFSDRYYEQSPQAFANKDTALVLAYSIIML
NTDQHNMQVKKKMTEEDFIKNNRNINGGSDLPREMLSELYHSICRNEIKTTPEQGMGYFE
MSPSRWIDLMRKSKSTSLYIVGDSQPFLDHDMFAIMSGPTIAAIAVVFDHSEHEEVLLAC
VDGFLGVAKISAFHHLEDVLDDLVVSLCKFTTLLNTSLVEEPVTAFGDDLKARLATETLF
TIANRYGDYIRTGWRNVLDCILRLHKLGLLPARVASDAADDSEVSAETVQGKPTHSSIST
SHIPVMGTPRKSSGLMGRFSQLLSLDSEEPRSQPTEQQLAAHQRTLQTIQKCRIDSIFTE
SKFLQPDSLLQLARALIWAAGRPQKVASSPDDEDTAVFCLELLIAITLNNRDRIVLLWQG
VYEHIANIVQSTVMPCALVEKAIFGLLRICQRLLPYKENLADELLRSLQLVLKLDARVAD
AYCENITQEVARLVKANAGHVKSQMGWRTVVLLLSITARHPDASEVGFEAIMYIMSEGAH
LSLSNYAFCIEASRQFAESRVGLIDRSIRALDLMADSANSLARWSQETKGTGEETDKVLE
AIREMWLKLLQALKKLSLDQREEVRNHALTSLQRCLTATEGVCLQSSTWSHAFDLVIFAL
LDDLLEISQNHSQKDYRNMEGSLVLAMKLVAKVYLQLLPDLFGLSSFCKLWLGVLSRMEK
YIKIKVRGKRSDKLQELIPELLKNILIAMKNRGILAKRSTIGGDSLWELTWLHANNISTS
LQSDVFPSQEYEQHSSAGSPRGPNGVESRD
NT seq 4233 nt   +upstreamnt  +downstreamnt
atggggcggccaaggctgccgggcgccgccgggatcgaccccatcgcggaggagccacct
cattccgcagccgccgcgggggatggcggcgacgcggccggcctcgcctgcgcgatctcc
gccgaggccagcgccgtgctggccgtcatgcgccgcagcctccgccacccgcgcgccgcc
gccgacgacgccgcggcggaccacccgctcgtctcctccctcaaggcgctgcgccgcctc
gtcttctccccctccgccgccgccgcgcccgcgggcgcggtgctgcggcccttcctcgac
gcggtccgctccgaggacgccggcgccgcggtcacctcggcgtcgctggccgcgctccac
gaggtgatggcgctcatgggcccgtccctcacgggcgccgcgctgcgggaggtcgtggac
gccgtcgccagctgccggttcgaggccggggccgaggccgccgccgaggaggccgtgctg
atgcggatgctgcaggcgctgctcgcctgcctgcgcgcacccgccgcccccgccctcggg
gaccagcacgtctgcactgccgtcaacacgtgcttccgtgtcgtccaccaggccggcgcc
aagggcgagctcctgcagcgattctcgtggcacgcgatgcacgagctcatccgatgtgtc
ttcgcccgcctcccgcagattgggagtggtgatgggcctgacggttccgtcaaaccagag
atgggtggcatggataaaaaccatccttttgggattggacaaatggaaaatggcaatggg
agctatgcatctgaggcagttacatctgatgagaattctgcagatggcagtggcattgtt
gtggagccttacgggatcccatgcatggtggagatttttcatttcctctgctccctcctc
aatgttgtcgagcaaattggagttgatgaagatctgccattgtttgctctgaagttgatc
aattcagcaattgagcttggtggatcttcaattcgtaagcacccaaaattgctgtcatta
gttcaagatgagcttttccgaaacctaatgcagtttgggttgtccatgagcccacttatc
ctttcaatggtgtgcagcattgtgctaaatctttatcatcatctccggactgagctcaaa
ttgcagcttgaggcattcttttcttgtataatcctaaggcttgcacaaccccgattcgga
gcaacatatcatcagcaggaggttgcaatggaagctcttgttgatttttgtcgacaaaag
aatttcatggtggagatgtatgccaatctggactgtgacataacctgcaggaatattttt
gaggaacttgcaaatcttctgtcaaagagtgcatttcctattaactgcccattgtcttcc
atgcacattcttgctctggaaggtctgatctctgtgatccaagggatggctgatcggatt
gggaatgctacttcacgccctgagctcctgcctgtggagcttgatgaatacactcccttc
tggactgttaagtgtgagaatttttcagatcctcagcattgggtgaagtttgtccgtcaa
agaaagtatgtcaaaagaagactaatgattggtgctgatcacttcaacagagacccaaag
aagggtctggaatttcttcaaggcactcatttgttgcctgagaagcttgatccccaaagt
gtggcttgttttttccgctatacagctggtttggacaagaatcttgtaggagactttcta
ggcaatcatgatgagttttgtgttcaggtgcttcatgagtttgctcaaacctttgacttc
caggagatgaaccttgatacagctctgagactatttttggagacatttcgtctgcctgga
gaatctcagaagatacagagggttcttgaggctttctcagacagatactatgagcagtcc
ccacaggctttcgcaaacaaggacactgctttagtgcttgcttactcaattataatgctg
aacactgatcagcataacatgcaagtaaagaagaaaatgactgaggaggacttcatcaag
aacaacaggaacataaatgggggtagtgaccttccgcgtgagatgctgtctgaactatac
cactccatatgccgaaatgagattaagaccacaccagagcagggtatgggatattttgaa
atgtctcccagccgctggatagatttaatgcggaagtcgaagtcaacatctctgtatata
gttggtgattctcagccctttctggatcatgatatgtttgctatcatgtctggtcctact
attgctgccattgcagtggtgtttgatcattcggaacatgaagaagttctgttggcctgt
gtggatggcttcttgggtgtcgcaaaaatctcagcatttcatcatcttgaagatgttttg
gatgatcttgtcgtttctctctgcaaattcaccactcttttaaacacctctttggttgag
gaaccagttactgcctttggggatgacctgaaggctagattggcaactgagacattgttt
accatagctaatagatatggggactacatacgtactggctggaggaatgttttggattgc
atattgaggctgcataagttaggccttcttcctgcccgtgttgctagtgatgcagctgat
gattcagaagtttctgctgaaactgtccaaggaaagcctactcatagctcaatttccaca
tctcatattccagttatgggtacgcctcggaaatcctctggacttatggggagatttagt
cagctgctgtcacttgacagcgaagaaccaaggtcacagcccactgagcagcaacttgct
gcccatcagagaactctacagacgattcagaaatgccgaatagatagtatatttacagag
agcaaattcttgcaacctgattcactattacaacttgctagggcactgatttgggctgca
ggacgacctcaaaaggttgccagctcaccagatgatgaggacacagctgtattctgtctg
gaactgctaatcgcaattacgcttaacaaccgagaccgaattgtgcttctctggcaagga
gtttatgagcatattgccaacatagttcagtcaacagttatgccatgtgctcttgtggag
aaagctatttttggacttctgcgcatatgccagaggttattaccatataaagagaacctt
gcggatgagctgctgaggtcattgcaattagttctcaagctggatgcgcgtgtagcagat
gcatactgtgaaaacatcactcaggaggttgcacgccttgtcaaagcaaatgctggacac
gtaaaatcacaaatgggctggagaactgtagtgttactgctctccattacagctcgacac
cctgatgcttcagaagtaggctttgaggctatcatgtatatcatgtccgagggtgctcac
ctttcactatcaaattatgctttctgtatcgaagcgtcacggcagtttgctgaatccagg
gttggtctaattgacagatccattcgtgccctggatctgatggctgattcagccaatagt
cttgcccgatggtcacaagagacaaaagggacaggcgaggaaactgacaaagtgttggaa
gcaatcagggagatgtggctcaaattgctgcaagcactgaaaaagttgagtttggatcag
agagaggaggtgagaaatcacgcgctaacttcgcttcagcgatgcctaacagcaacagaa
ggggtgtgccttcagagctccacatggtcacatgctttcgatctcgtcatattcgcgctg
ctggatgacttactagagatcagccagaatcactcgcagaaggactacaggaacatggaa
ggatcccttgtgctcgccatgaaactagtcgcgaaggtctatctgcaactactgccagat
ctttttgggctaagcagcttctgcaagttgtggctaggagtcctcagccggatggagaag
tacatcaagatcaaggtccgtggcaagcgcagcgacaagctgcaagagctgatccctgag
ctgctcaagaacattctaattgcgatgaagaacagggggatcctcgcaaagaggagcacc
attgggggcgacagcttgtgggagttgacatggcttcatgcgaataacatctcgacgagt
ttgcagtctgatgttttcccaagccaggagtatgagcagcacagcagtgccggtagcccg
agaggacccaacggcgttgagtcccgggactag

DBGET integrated database retrieval system