KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328603
Entry
4328603           CDS       T01015                                 
Name
(RefSeq) lipoxygenase 2.3, chloroplastic
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4328603
   00592 alpha-Linolenic acid metabolism
    4328603
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4328603
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4328603
NCBI-ProteinID: XP_015626775
UniProt: A0A0N7KEV1 Q6H7Q6
LinkDB
Position
2:complement(5276652..5282849)
AA seq 926 aa
MIHPNQPLALSAAKNASTVVVGSPLLAASPASSPAAACCSSQLQQRRAAGPGRRGAGRLA
APRCSTIEQAAGVSSAVTVDRTLTVTATVTVQPPIGVVYAARGIDDLTDLIGKTLLLELV
SSELDPRTGKEKETVSAFAHRTMKQDTYEAEFAVPATFGPVGAVLVENEHHREMFVKEIC
LVTGADDSSAVTFDCNSWVHSKFDNPDRRIFFTVKSYLPAQTPKGIEALRKKELETLRGD
GTGERKFFDRVYDYDVYNDLGDPDFKIEHLRPVLGGDEHPYPRRCRTGRPHTEIDPRTEK
RRGPVYVPRDEQFSDVKGMTFSATTLRSGLHAMLPALEPLLANQELRFPHFPAIDGLYSV
GIPLPAQLAAAGAATATAGGAAASSSTSTNIVGGVIPRLVRMIEDTTDHVLRFDVPEMFE
RDRFSWFRDEEFARQVLAGVNPICIQLLTEFPIVSKLDPEVYGPPESALTKELLESQIVE
SVTVEEAMAQRRLFILDYHDVFLPYVHRVRERPETTLYGSRTVFFLTGAGTLSPLAIELA
RPQSPTRPQWRRAFVHGPDATASWLWKLAKAHVLSHDTGYHQLVSHWLRTHCCVEPYIIA
ANRQLSRMHPVHRLLHPHFRYTMEINALARESLINADGIIEESFWPGRYAMELSSVAYAA
TWRFDAEALPEDLVRRGLAVRQEDGELELTIKDYPYANDGLLVWNSIKQWASDYIDFYYK
SDEEVACDEEVRAWWEEVRTKGHADKKDEPWWPAVDTRDGLIGVLTTIMWVTSGHHAAVN
FGQYHYGGYFPNRPTVMRKKMPVEENKEEEMKKFMEMPEHVLLDTMPSKMQAITIMATLD
ILSSHSPDEEYMGEHAEPAWLAEPRVKAAFERFAGRMKEIEGIVDERNNDPELRNRCGAG
IVPYELLKPFSTPGVTGRGIPNSISI
NT seq 2781 nt   +upstreamnt  +downstreamnt
atgattcaccccaaccagccgctggcgctgtccgcggcgaagaacgcgagcaccgtcgtc
gtcggctcgccgctcctcgcggcgtcgccggcctcctcccccgcggcggcgtgctgtagc
agccagctgcagcagcggcgagccgccgggcccgggaggaggggcgccggtaggctcgcg
gcgccgaggtgcagcaccatcgagcaggccgccggcgtgtcgtcggccgtgacggtggac
aggacgctgacggtgaccgccacggtgaccgtgcagccgcccatcggcgtcgtctacgcc
gcccgcggcatcgacgacctcaccgacctcatcggcaagacgctcctcctcgagctcgtc
agctccgagctcgacccaaggacggggaaggagaaggagacggtgagcgcgttcgcgcac
aggacgatgaagcaggacacgtacgaggcggagttcgccgtgccggcgacgttcgggccg
gtgggcgccgtgctggtggagaacgagcaccaccgcgagatgttcgtcaaggagatctgc
ctcgtcaccggcgccgacgactcctccgccgtcaccttcgactgcaactcctgggtccac
tccaagttcgacaaccccgaccgccgcatcttcttcaccgtcaagtcgtacctgccggcg
cagacgcccaaggggatcgaggcgctgaggaagaaggagctggagacgctgcgcggcgac
ggcaccggcgagcgcaagttcttcgaccgcgtctacgactacgacgtctacaacgacctc
ggcgaccccgacttcaagatcgagcacctccgccccgtcctcggcggcgacgaacacccc
taccctcgccgctgccgcaccggccgcccccacaccgagatcgatccgcggacggagaag
aggagggggccggtgtacgtgcctcgggacgagcagttctcggacgtgaaggggatgacg
ttcagcgcgacgacgctgaggtcggggctgcacgcgatgctgccggcgctggagccgctg
ctggcgaaccaggagctgaggttcccgcacttcccggccatcgacggcctctacagcgtc
ggcatcccgctgccggcgcagctcgccgccgccggcgccgccactgccacggccggcggc
gccgcggcctcctcctccacctccaccaacatcgtcggcggcgtcatcccccgcctcgtc
cgcatgatcgaggacaccaccgaccacgtcctccgcttcgacgtccccgagatgttcgag
cgagataggttctcgtggttcagagacgaggagttcgcgaggcaggtgctggctggcgtc
aaccccatctgcatccagctcctaacggagtttcccatcgtgagcaagctggacccggag
gtgtacgggccaccggagtcggcgctgacgaaggagttgctggagagccagatcgtggag
tcggtgacggtggaggaggcgatggcgcagcggcggctcttcatcctggactaccacgac
gtgttcctcccctacgtgcaccgcgtccgcgagcggccggagacgacgctctacggctcc
cgcacggtgttcttcctcaccggcgccggcacgctgtcgccgctcgccatcgagctggcg
cggccgcagtcgccaacgaggccgcagtggaggcgcgccttcgtccacgggcccgacgcc
acggcgtcgtggctgtggaagctcgccaaggcgcacgtcctctcccacgacaccggctac
caccagctcgtcagccactggctccgcacccactgctgcgtcgagccgtacatcatcgcc
gccaaccggcagctcagccggatgcacccggtgcaccgcctcctccacccacacttccgc
tacaccatggagatcaatgccctggccagggagagcctcatcaatgccgacggcatcatc
gaggagtccttctggcccgggaggtacgccatggagctcagctccgtcgcctacgccgcc
acgtggcgcttcgacgccgaggccctgcccgaggacctggtgcgccgcgggctcgccgtt
cgacaggaggacggcgagctcgagctcaccatcaaggactacccgtacgccaacgacggg
ctgctggtctggaactccatcaagcagtgggcgtcggattacatcgacttctactacaag
tccgacgaggaggtcgcctgcgacgaggaggtgcgggcgtggtgggaggaggtgcgcacc
aaggggcacgccgacaagaaggacgagccgtggtggccggcggtggacacccgggacggg
ctcatcggcgtcttgaccaccatcatgtgggtgacctccggccaccacgccgccgtcaac
ttcgggcagtaccactacggcggctacttcccgaaccggccgacggtgatgaggaagaaa
atgccggtggaggagaacaaggaggaggagatgaagaagttcatggagatgccggagcac
gtgctgctggacaccatgccgtccaagatgcaggccatcacgatcatggcgacgctggac
atcctgtcgtcgcactcccccgacgaggagtacatgggggagcacgccgagccggcgtgg
ctggcggagccgagggtcaaggcggcgttcgagaggttcgcagggaggatgaaggagatc
gagggcatcgtcgacgagcggaacaacgacccggagctcaggaacaggtgcggcgccggc
atcgtgccgtacgagctgctcaagccgttctccacgcccggggtcaccgggaggggcatc
ccaaacagcatctccatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331824
Entry
4331824           CDS       T01015                                 
Name
(RefSeq) probable lipoxygenase 6
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4331824
   00592 alpha-Linolenic acid metabolism
    4331824
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4331824
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4331824
NCBI-ProteinID: XP_015630875
UniProt: Q8H016
LinkDB
Position
3:4187055..4193539
AA seq 918 aa
MELTGLTRAAAAATVTPPAPRRGWGELRFAPLLPGERHGRRKVVVAAISEEVPRLAASPS
SGIKGGGAGERRPAPEKVALRAALTVRRKQKEDIKEAVAGHLDALWDMVGRNVVLELIST
KIHPRTKKPMQSGRVSIKDWCQKRGAKGDHVVYTAEFTVDADFGEPGAIAVANRHNREFF
LESIVVEGGGLPCGPVHFACNSWVQSTRELPTKRVFFSNKPYLPSETPPGLRELREKELK
DLRGDGTGVRKLSDRIYDYATYNDLGNPDKGKEFIRPILGGEKIPYPRRCRTGRPPTDTN
MLAESRVEKPHPIYVPRDEAFEELKQGAFSSGRLRAVLHTLIPSLIASISAETHNFQGFH
HIDNLYKEGLRLKLGLQEHLFQKIPLVQKIQESSEGMLRYDTPSILSKDKFAWLRDDEFA
RQAVAGINPVNIERLQVFPPVSKLDPAIYGPPESSITETHIAGHLNGLTVQQAMDEAKLF
IVDYHDAYLPFLDRINAIDGRKAYATRTIFFLTEAGTLKPIAIELSLPPAKPGEPRPSKV
LTPPYDATSNWLWMLAKAHVSSNDAGVHQLVNHWLRTHATMEPFILAAHRHMSAMHPIFK
LLHPHMRYTLEINALARQSLINADGVIESCFTPGPVSGEISAAYYRNHWRFDLEGLPSDL
IRRGVAVEDATQPHGVRLLIEDYPYANDGLLLWSAIRSWVESYVQLYYPDAGTVQCDLEL
QGWYHESIHVGHGDLRHAPWWPPLSTPVDLASILTTLVWLASAQHAALNFGQYPLGGYVP
NRPPLIRRLLPDLERDAAEYAAFLADPHRFFLNAMPGVLEATKFMAVVDTLSTHSPDEEY
LGEGRDEGGVPWTADEAAVAAHGMFAADVRRAEETIERRNADHGRKNRCGAGVLPYELLA
PSSPPGVTCRGVPNSISI
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggagttgaccggcctgacgcgggcggcggcggcggccaccgtgacgccgccggcgccg
cgccggggatggggcgagctccggttcgcgccgctgctgcccggcgagcggcatgggagg
aggaaggtggtggtggcggccatcagcgaggaggtgccgcggctggcggcgtcgccgtcg
tcggggatcaagggcggcggggccggggagaggcggccggcgccggagaaggtggcgctg
cgggcggcgctgacggtgcggcggaagcagaaggaggacatcaaggaggcggtggccgga
cacctcgacgcgctctgggacatggtcggccggaatgtcgtgctcgagctcatcagcacc
aagatccacccaaggaccaagaagccgatgcagagtggccgtgtgtccatcaaggactgg
tgccagaagaggggagccaagggcgaccacgtcgtgtacacggccgagttcacggtggac
gccgacttcggcgagccgggcgccatcgccgtggccaaccggcacaacagggagttcttc
ctggagagcatcgtcgtcgagggcggcggcctgccgtgcgggcctgtgcacttcgcctgc
aactcctgggtgcagtccaccagagagctgccaacaaagagggtgttcttcagcaacaag
ccatatttaccttctgaaacacctcccgggcttagagaactaagggagaaggaacttaaa
gacctaagaggagatggcacaggtgttcggaaattatctgacagaatatatgattatgcc
acatacaatgatttgggaaatccagataaggggaaggaattcatcaggccgatccttgga
ggagagaagataccttacccacggcgttgccggactggtcgcccgccaacggataccaac
atgctagcagagagcagagtagagaagccgcatccaatatatgttccccgcgatgaggca
tttgaggagctgaagcagggtgccttctcatcagggaggctccgggcagtacttcacaca
ttgatcccatcgctgattgcatccatctcagctgagacccacaatttccaaggcttccac
cacatcgacaacctctataaggagggcctcaggctgaagctgggcctgcaagaacaccta
ttccagaagataccacttgttcagaagattcaagagtcgagcgaagggatgcttcgttac
gacactcctagcattctttctaaggacaagtttgcatggctccgtgacgatgagtttgct
aggcaggctgttgcaggaataaacccagttaacattgagcggctgcaggttttcccacca
gtgagcaagctggatcctgcaatctatggaccaccagaatcatcaattactgaaacacac
atagctggacatctcaacggactcacagtacaacaggcaatggacgaagcaaagctgttc
atagtggactaccatgacgcatacctgccattcttggaccggatcaatgcgatagatgga
cggaaagcatatgcgacccgaacaatcttcttcctgacagaagctggcacactgaaaccg
atcgctatcgagcttagtcttcctccagccaagccaggggagcctcggccaagcaaggtc
ctgacgcctccctatgatgctacctcgaattggctctggatgcttgccaaggcccatgtc
agctccaacgatgctggtgtccatcagctggtcaatcactggcttaggacgcatgcaaca
atggagccgttcatcctggcggcgcaccggcatatgagcgcaatgcaccccatcttcaag
ctcctgcacccgcacatgcggtacacgctcgagatcaacgcgcttgcacggcagagcctc
atcaacgccgacggagtgatcgagtcctgcttcacccccggccctgtctccggcgagatc
agcgctgcttactaccgtaaccactggcggttcgacctggagggcctcccttccgacctc
atccgcaggggagttgctgtggaggacgcgacgcagccccatggcgtcaggcttctcatc
gaggactacccatacgcgaatgatgggctcctgctctggtcggcaattcgaagctgggtg
gagtcctacgtgcagctctactacccggacgccgggacggtgcagtgcgatcttgagctg
caggggtggtaccacgagtcgatccatgtcgggcacggcgacctccggcacgcgccgtgg
tggccgccgctctccacgccggtggacctggcgtccatcctgacgacgctggtctggctc
gcgtcggcgcagcacgcggcgctcaacttcgggcagtacccgctgggcgggtacgtcccg
aaccggccgccgctgatacggcggctgctgccggacctggagcgcgacgcggcggagtac
gccgcgttcctcgccgacccgcaccgcttcttcctgaacgcgatgcccggggtgctggag
gcgaccaagttcatggcggtggtggacacgctgtcgacgcactcgcccgacgaggagtac
ctcggcgaggggcgggacgagggcggcgtgccgtggacggcggacgaggcggccgtggcg
gcgcacggcatgttcgcggccgatgtgcgacgcgccgaggagaccatcgagaggcggaac
gccgaccacggccggaagaaccggtgcggcgccggggtgctgccgtacgaactgctggcg
cccagctcgccgccgggggtcacctgccgcggcgtgcccaacagcatctccatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338358
Entry
4338358           CDS       T01015                                 
Name
(RefSeq) linoleate 9S-lipoxygenase 6
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4338358
   00592 alpha-Linolenic acid metabolism
    4338358
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4338358
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4338358
NCBI-ProteinID: XP_015639185
UniProt: A0A0P0WKH4 Q0DJB6
LinkDB
Position
5:13734462..13740531
AA seq 847 aa
MQMPFCPKLWSSAAPAPVQPGSVVINGTVVVANHFGLSAPGKSTTLRLFSGTEVDHETRK
GRLSAEAALRGGKKTRHGKASTTMYQVTFFVDGEFGTPGAVAVKNGNRNDQFFLRHVRLD
LAEDRSIHFDCNSWVYPYKKTTSDRVFFINTSYLPDKTPEALRLLREEELRSLRGNGRGE
RKDWERIYDFDYYNDLGNPDNDDHVRPVLGGTKTHPYPRRCRTGRPLSKTDGVTETRKHK
LINLDYYIPPDERFSPGKLAEVLAMGVQAVTHFVIPEARSIFHGDVVNFKSTEQLRADLY
GKPPQPAADARVMDELKSSVPSHKTYKQVSRIVKDNPAKFPTPQVIHYDTEAWRSDEEFA
REMLAGLNPVVIKRLEVFPPNKSKITTDDIMTQIGGLTIQQAMEQKRMYILDHHDYLMPY
LRRINTEGVCVYASRTLLFLRDDGALRPVAIELSLPDGGVGGSEISRVFLPASQGTDAHL
WHLAKTHVAVNDSGYHQLISHWLFTHATVEPFIIATRRQLSAMHPIHKLLDPHFKDNMQI
NTLARSILLNAGGLLEKTMYPGKYSMEMSSDIYAHWRFTEQSLPNDLIKRGMASRDPKAR
GGVSLHIEDYPYAVDGIDVWLAIEGWVRSYCDHFYHADAAVAGDAELQAWWDDVRRVGHG
DRQGDAACWLDLDTVAGLVETLSTLIWTASALHAAVNFGQYGYAGYPPNRPTRCRRFVPL
PGSPEMAQLEADPGRFFLETVPDRFTATLGIALIEVLSNHTSDEVYLGQRATSTWTDDGE
VLLLLDRFRDELRRVEKRVEERNKDPRLVNRRGPVRVPYTLLYPDAGDVAGKEKGITGRG
IPNSVSI
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgcaaatgcccttctgcccgaagctctggagctcggcggcgccggcgccggtgcagccg
gggagcgtggtcatcaatggcacggtggtcgtcgccaaccacttcggcctctcggctccc
ggcaagtccaccaccctccgcctcttcagcggcacggaggtcgatcacgagacgaggaag
gggaggctgagcgcggaggcggcgttgaggggagggaagaagacgaggcatgggaaggcg
agcacgacgatgtaccaggtgacgttcttcgtcgacggcgagttcgggacgccgggcgcc
gtggccgtcaagaacgggaaccggaacgaccagttcttcctccggcacgtccggctggac
ctcgccgaggaccggagcatccacttcgactgcaactcctgggtctacccctataagaag
accacctccgaccgcgtcttcttcatcaacacgagctacctgccagataagacgccagag
gcgctgcggctgttacgggaggaggagctcagaagcctgagagggaatgggcgcggggag
aggaaggactgggagcgcatctatgacttcgactactataacgacctcggcaaccctgac
aacgatgaccatgtccgccccgtcctcggtggcaccaagacccacccctaccctcgccgc
tgccgcaccggccgccccctcagcaagaccgacggggtgacggagacgcggaagcacaag
ctgataaacctggactactacatcccgccggacgagcggttcagcccggggaagctggcg
gaggtgctggcgatgggggtgcaggcggtgacccacttcgtcatcccggaggcccgctcc
atcttccacggcgacgtcgtcaacttcaagtccacggagcagctgcgcgccgacctctac
ggcaagccgccgcagccggcggcggacgccagggtcatggacgagctcaagtcctccgtg
ccgtcgcacaagacgtacaagcaggtttccaggattgtcaaggacaaccccgccaagttc
cccacccctcaagtcatccactatgacactgaggcgtggaggagcgacgaggagttcgcg
agggagatgctggcagggctcaacccggtggtgatcaagcggctggaggtgtttcctcca
aacaagagcaagataaccacggacgatatcatgacccagattggaggtctgaccattcaa
caggcgatggagcagaaacggatgtacatcctggaccaccacgactacctgatgccatac
ctccggcggataaacacggagggggtgtgcgtgtacgcgtcgcgcacgctgctcttcctc
agggacgacggcgccctccggcccgtcgccatcgagctcagcttgcccgacggcggcgtc
ggcggcagcgagatcagcagggtgttcctcccggcgagccagggcaccgatgcgcacctt
tggcacctcgccaagactcatgtcgccgtcaacgattctgggtaccatcagctcatcagc
cactggctgttcacgcacgcgacagtggagccgttcatcatcgcgacgaggaggcagctg
agcgcgatgcacccgatccacaagctcctggacccgcacttcaaggacaacatgcagatc
aacaccttggccaggagcatactgctcaacgccggtggcctcctggagaagaccatgtac
ccggggaagtactccatggagatgtcctccgatatctatgcccattggaggttcaccgag
cagtccctgcctaatgatctcatcaagagggggatggcgtccagggaccccaaggcgcgc
ggcggcgtgtccctccacatcgaggactacccgtacgccgtcgacggcatcgacgtgtgg
ctcgccatcgagggctgggtgcgcagctactgcgaccacttctaccacgccgacgcggcg
gtggccggcgacgccgagctgcaggcgtggtgggacgacgtccgccgcgtgggccacggc
gaccggcagggcgacgccgcgtgctggctggacctcgacaccgtcgcgggcctcgtcgag
acgctgtcgacgctcatctggaccgcgtcggcgctgcacgccgccgtcaacttcggccag
tacggctacgccgggtacccgccgaaccggccgacgcggtgccggcggttcgtgccgctc
ccggggtcgccggagatggcgcagctggaggccgacccgggccggttcttcctggagacg
gtgcccgaccggttcacggcgacgctggggatcgcgctgatcgaggtgctgtccaaccac
acctccgacgaggtgtacctcgggcagcgcgcgacgtcgacgtggacggacgacggcgag
gtgctgctgctgctggacaggttccgcgacgagctccggcgggtggagaagagggtggag
gagaggaacaaggaccccaggctcgtcaaccggaggggccccgtgagggtgccgtacacg
ctgctctacccggacgccggcgacgtcgccggcaaggagaaggggatcaccgggagaggg
atacccaacagcgtctccatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345993
Entry
4345993           CDS       T01015                                 
Name
(RefSeq) lipoxygenase 7, chloroplastic
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4345993
   00592 alpha-Linolenic acid metabolism
    4345993
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4345993
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4345993
NCBI-ProteinID: XP_015650717
UniProt: P38419 D1G597
LinkDB
Position
8:complement(25216458..25224188)
AA seq 924 aa
MLRPQLNPSSHTTTTSSSSSTQLFASSSCIASLRRPSSSSSSVVAAARRTRGQGSSRVVV
VCASSSATASRGDSSSDMAAAAAVRVKAVATIKVTVGELINRSIDIRDLIGRSLSLELVS
SELDAKTGKEKATVRSYAHNVDDDDHSVVTYEADFDVPSGFGPIGAIIVTNELRQEMFLE
DINLTASDGAGNSTVLPIRCNSWVQPKSVGDEGTPSKRIFFANKTYLPGQTPAGLRSYRK
NDLQQKRGDGTGEREADDRVYDYDVYNDLGNPDSNGDLARPVLGGNKQFPYPRRCRTGRP
PSKKDPKSETRKGNVYVPRDEEFSPEKEDYFLRKTVGSVLQAAVPAAQSLLLDKLKWNLP
FPSFFVIDKLFEDGVELPGVDKLNFLESVVPRLLEHLRDTPAEKILRFETPANIQKDKFA
WLRDEEFARETLAGINPYAIELVREFPLKSKLDPAVYGPAESAITADLLEEQMRRVMTVE
EAISQKRLFMLDFHDLFLPYVHKIRSLDHTTMYGSRTVFFLTDDGTLQLLAIELTRPASP
SQPQWRQVFTPSTDATMSWLWRMAKAHVRAHDAGHHELITHWLRTHCAVEPYIIAANRQL
SEMHPIYQLLRPHFRYTMRINARARSALISAGGIIERSFSPQKYSMELSSVAYDKLWRFD
TEALPADLVRRGMAEEDPTAEHGLKLAIEDYPFANDGLLIWDAIKTWVQAYVARFYPDAD
SVAGDEELQAFWTEVRTKGHGDKKDAPWWPKLDSPESLAHTLTTIVWVAAAHHAAVNFGQ
YDFGGYFPNRPSIARTVMPVEEPVDGAAMERFLDNPDQALRECFPSQVQATVVMAVLDVL
SSHSTDEEYLGGEQTRPWNSDAAVQAAYDGFAARLKEIEGVIDGRNKDRKLKNRCGAGIL
PYQLMKPFSDSGVTGMGIPNSTSI
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgttgcgtcctcagctcaatccatctagccacacgacgacgacgagcagcagcagcagc
acgcagctgttcgcatcctcgtcgtgcatcgctagccttcgccggccgtcgtcgtcgtcg
tcgtcggtggtcgccgccgcacgccggacgcgggggcaaggtagcagtcgggttgttgtt
gtgtgcgcgtcgtcgtcggcgacggcgagcaggggagatagttcttcggacatggcggcg
gcggcggcggtgcgggtgaaggcggtggcgacgatcaaggtcaccgtcggcgagttgatc
aacaggtcgatcgacatcagggatctcatcggcaggtcgctctccctcgagctcgtcagc
tccgagcttgacgcgaagaccgggaaggagaaagcaactgtgcggagctacgcgcacaat
gtggacgacgacgatcatagcgtcgtcacctacgaggccgacttcgacgtgccgagtgga
ttcggccccatcggcgccatcatcgtcaccaacgaactccggcaggagatgttcctcgag
gacatcaacctcaccgccagcgatggcgccggcaactccactgtcctccccatccgctgc
aactcctgggtccaacccaagtccgtcggcgatgagggcacgcctagcaaacgcatcttc
ttcgccaacaagacttacttgccgggacagacgccggcggggctccggagctaccggaag
aatgacctccagcagaagcgcggtgacggcactggcgagagggaggccgacgaccgtgtc
tacgactacgacgtttacaacgacctcggtaacccggacagcaacggcgatctcgcccgc
cccgtccttggcggcaacaagcagttcccctaccctcgccgctgccgcaccggccgcccc
ccctccaaaaaagaccctaagtcggagacgaggaagggcaacgtgtacgtgccgagggac
gaggagttctcaccggagaaggaggactacttcctccgcaagacggtggggtcggtgctc
caggccgccgtgccggcggcgcagtcgctgctcctcgacaagctgaaatggaaccttccg
ttcccgtccttcttcgtcatcgacaagctgttcgaggacggcgtcgagcttcccggcgtc
gacaagctcaacttcctcgagagcgtcgtgccccgcctgctcgaacacctccgcgacacc
cccgccgagaagatcctccgcttcgaaactccggccaacatccaaaaggacaagttcgca
tggctcagagacgaggagttcgcgagggaaacgctcgctggcatcaacccgtacgccatc
gagctcgtcagggaatttccgctgaagagcaagctcgacccggcggtgtacggtccggcg
gagtcggcgatcaccgccgatttgctggaggagcagatgaggcgcgtgatgacggtggag
gaggcgatcagccagaagaggctgttcatgctcgacttccatgacctcttcttgccgtac
gtgcacaagatccggtcgctggatcacaccaccatgtacggctcgcgcaccgtcttcttc
ctcaccgacgacggcacgctgcagctgctcgccatcgagctcacccggccggcctcgccg
tcgcagccgcagtggcggcaggtgttcacgccgtccacggacgccaccatgtcgtggctg
tggcggatggccaaggcccacgtccgcgcccacgacgccggccaccacgagctcatcacc
cactggctgcgcacgcactgcgcggtggagccatacatcatcgcggcgaaccggcagctc
agcgagatgcaccccatctaccagctgctgcgcccgcacttccgctacacgatgcggatc
aacgcgcgcgcccgctcggcgctgatcagcgccggcggcatcatcgagcgatccttctcg
ccgcagaagtactccatggagctcagctccgtcgcctacgacaagctctggcgcttcgac
acggaggcgctccccgccgacctcgtccgccgcggcatggccgaggaggaccccacggcg
gagcacggcctcaagctcgccatcgaggactacccgttcgccaacgacggcctcctcatc
tgggacgccatcaagacctgggtccaggcgtacgtcgcgcggttctaccccgacgccgac
agcgtcgccggcgacgaggagctccaggcgttctggaccgaggtgcgcaccaaggggcac
ggcgacaagaaggacgccccgtggtggccgaagttggactcgccggagagcctcgcccac
acgctgaccaccatcgtctgggtggcggcggcgcaccacgccgccgtcaacttcgggcag
tacgacttcggcggctacttccccaaccggccgtccatcgcgcgcacggtcatgccggtg
gaggagcccgtggacggcgccgccatggagaggttcctggacaacccggaccaggcgctc
cgcgagtgcttcccgtcacaggtgcaggcgacggtggtgatggcggtgctcgacgtgctg
tccagccactccaccgacgaggagtacctcggcggcgagcagacgaggccgtggaacagc
gacgcggcggtgcaggcggcgtacgacgggttcgcagcccggctcaaggagatcgagggc
gtcatcgatggccggaacaaggatagaaagctcaagaacaggtgcggcgccggcatcctg
ccgtaccagctgatgaagcccttctccgactccggcgtcaccggcatgggcatccccaac
agcacatccatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345994
Entry
4345994           CDS       T01015                                 
Name
(RefSeq) probable lipoxygenase 8, chloroplastic
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4345994
   00592 alpha-Linolenic acid metabolism
    4345994
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4345994
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4345994
NCBI-ProteinID: XP_015650450
UniProt: Q84YK8
LinkDB
Position
8:25240911..25250053
AA seq 941 aa
MLRPQLNPSSSHHHTTTTSSSSSTQLYFASSSCIASLRRPSPPSLIAGAGCRTTRRRQQG
RQRVVVRCASSSAASSASEAARRGTGSSDMAPAAVVKVKAVATIKVTVEGLLNSLRPSKA
IDNIRDLIGRSLFLELVSSELEAKTGKKKATVHSYAHKVDDDDHGVVTYEADFDVPTGFG
PIGAVVVTNELGQEMFLEDLNLTAGDGAGNSTVLPIRCNSWVQPKSSIDEGTPGKRIFFA
KAYLPGQTPAGLRSYREEDLKQKRGNGAGQREADDRVYDYDVYNDLGNPDSNGDLARPVL
GGSKQFPYPRRCRTGRPPSKKDPKSETRKGNVYVPRDEEFSEVKNAQFLLKTLQSVLHAA
VPAAQSALIDNLSLNLPFPSFFVIDKLFEDGVELPGVEKLGFLHSIVPRLLELLRDSPGD
KILLFDTPANVQKDKFAWLRDEEFARETLAGINPYAIELVREFPLKSKLDPAVYGPAESA
ITADLLEEQMRRVMTVEEAISQKRLFMLDFHDLFLPYVHKIRSLKHTTMYGSRTIFFLTD
DGTLRLLAIELTRPASPSQPQWRQVFTPSTDTTKSWLWRMAKAHVRAHDAGHHELITHWL
RTHCAVEPYIIAANRQLSEMHPIYQLLHPHFRYTMRINALARSRLISAAGIIELSFSPQK
YSMELSSVAYDKLWRFDMEALPADLVRRGMAEEDPTAEHGLRLAIEDYPFANDGLLIWDA
IKTWVQAYVARFYPDADSVAGDEELQAFWTEVRTKGHGDKKDAPWWPKLDSPESLAHTLT
TIVWVAAAHHAAVNFGQYDFGGYFPNRPSIARTVMPVEEPVDGAAMERFLDNPDQALREC
FPSQVQATVVMAVLDVLSTHSTDEEYLGGEQTRPWNSDAAVQAAYAGFTARLKEIEGVID
GRNKDRKLKNRCGAGILPYQLMKPFSDAGVTGMGIPNSTSI
NT seq 2826 nt   +upstreamnt  +downstreamnt
atgctgcgtccccagctcaatccatcgtccagccaccaccatacgacgacgacgagcagc
agcagcagcacgcagctgtacttcgcctcctcgtcgtgcatcgctagccttcgccggccg
tcgccgccgtcgctgatcgccggtgccggctgccggacgacgcggcggagacagcagggt
aggcagcgagttgttgtgaggtgcgcgtcctcgtcggcggcatcatcggcgtcggaggcg
gcgagaagagggaccggtagttcggacatggcgccggcggcggtggtgaaggtgaaggcg
gtggcgacgatcaaggtcaccgtcgaagggcttctcaacagcctgaggccgtcgaaggcg
atcgacaacatcagggatctcatcggaaggtcgctcttcctcgagctcgtcagctccgag
cttgaagcgaagacagggaagaagaaggcaacggtgcatagctacgcgcacaaggtggac
gacgacgaccatggcgtcgtcacctacgaggccgacttcgacgtgccgaccggcttcggc
cccatcggcgccgtcgtggtcaccaacgagctcgggcaggagatgttcctcgaggacctc
aacctcaccgccggcgatggcgccggcaactccaccgtcctccccatccgctgcaactcc
tgggtccagcccaagtccagcatcgacgagggcacgcctggcaagcgcatcttcttcgcc
aaggcttatctgccgggccaaactccggcgggtctccggagctaccgggaggaggacctc
aagcagaagcgcggcaatggcgctggccagagggaggccgacgaccgcgtctacgactac
gacgtgtacaacgacctcggcaaccccgacagcaacggtgacctcgcccgccccgtcctc
ggcggcagcaagcagttcccttaccctcgccgctgccgcactggtcgccccccttccaag
aaagacccgaagtcggagacgaggaaggggaacgtgtacgtgccgagggacgaggagttc
tcggaggtgaagaacgcgcagttcttgctcaagacgctgcagtcggtgctccacgccgcc
gtgccggcggcgcagtcggcgctcatcgacaatctgagcctgaacctgccgttcccgtcc
ttcttcgtcatcgacaagctgttcgaggacggcgtcgagcttcccggcgtcgagaagctc
ggcttcctccacagcatcgtgccccgcctgctcgagctcctccgcgacagccccggcgac
aagatcctcctcttcgacactccggccaacgtccaaaaggacaagttcgcatggctcaga
gatgaggagttcgcgagggagacgctcgctggcatcaacccgtacgccatcgagctcgtc
agggaatttccgctaaagagcaagctcgacccggcggtgtacggtccggcggagtcggcg
atcaccgccgatttgctggaggagcagatgaggcgcgtgatgacggtggaggaggcgatc
agccagaagaggctgttcatgctcgacttccatgacctcttcttgccgtacgtgcacaag
atccggtcgctgaagcacaccaccatgtacggctcgcgcaccatcttcttcctcaccgac
gacggcacgctgcggctgctcgccatcgagctcacccggccggcctcgccgtcgcagccg
cagtggcggcaggtgttcaccccgtccacggacaccaccaagtcgtggctgtggcggatg
gccaaggcccacgtccgcgcccacgacgccggccaccacgagctcatcacccactggctt
cgcacgcactgcgcggtggagccgtacatcatcgcggcgaaccggcagctcagcgagatg
caccccatctaccagctgctgcacccgcacttccggtacacgatgcggatcaacgcgctc
gcgcgctccaggctgatcagcgccgccggcatcatcgagctctcgttttcgccgcagaag
tactccatggagctcagctccgtcgcctacgacaagctctggcgcttcgacatggaggcg
ctccccgccgacctcgtccgccgcggcatggccgaggaggaccccacggcggagcacggc
ctcaggctcgccatcgaggactacccgttcgccaacgacggcctcctcatctgggacgcc
atcaagacctgggtccaggcgtacgtcgcgcggttctaccccgacgccgacagcgtcgcc
ggcgacgaggagctccaggcgttctggaccgaggtgcgcaccaaggggcacggcgacaag
aaggacgccccgtggtggccgaagttggactcgccggagagcctcgcccacacgctgacc
accatcgtctgggtcgcggcggcgcaccacgccgccgtcaacttcgggcagtacgacttc
ggcggctacttccccaaccggccgtccatcgcgcgcacggtcatgccggtggaggagccc
gtggacggcgccgccatggagaggttcctggacaacccggaccaggcgctccgcgagtgc
ttcccgtcgcaggtgcaggcaacggtggtgatggcggtgctcgacgtgctgtccacccac
tccaccgacgaggagtacctcggcggcgagcagacgaggccgtggaacagcgacgcggcg
gtgcaggcggcgtacgctgggttcacagctcggctcaaggagatcgagggcgtcatcgac
ggccggaacaaggacaggaagctcaagaatcggtgcggcgccggcatcctgccgtatcag
ctgatgaagcccttctccgacgccggcgtcaccggcatgggcatccccaacagcacatcc
atctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352505
Entry
4352505           CDS       T01015                                 
Name
(RefSeq) lipoxygenase 2.1, chloroplastic isoform X1
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4352505
   00592 alpha-Linolenic acid metabolism
    4352505
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4352505
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4352505
NCBI-ProteinID: XP_015620637
UniProt: Q2QNN5 Q0IMN5
LinkDB
Position
12:complement(22854588..22860224)
AA seq 922 aa
MLTATQTLAPAVLSRSHGAPSSFSSQPRRTAAAASRVSCTRVGALSEVVNGELVVGDQEQ
TTDDLLTRHKNVVADYTLSATVTVSLKQDDSTPQKVADMVNRDWLFLDFFSSHIEGMHTE
PQLARYSHMDGKGSFIYEASFSIPSSLDAVGAVQVVNRYSSEVYISDIDVHLCGGRHQWT
DITFHCNSWIDYNPNDQRFFFPLKSYLPSQTPRGVKNLRKEELRAIRGDGRGERKEWERI
YDYDVYNDLGDPDNDPATRRPVLGGRGRPYPRRCRTGRRRCRTDPSSESPPAKDGAGIYV
PRDEAFTERKAGAFATKKALSALSAFTTAQRVSGDRRRGFPSLAAIDALYEDGYKNRPSS
SQQEADNLEGYFREVLQKQVKLLLKGEKEEFKEELRKVFKFQTPEIHDKDKLAWFRDEEF
ARQTLAGMNPLSIQLVRDTDFPIFSKLDEETYGPGDSLITKELIEEQINGVMTAEEAVEK
KKLFMLDYHDVLLPFVHAVRELDDTTLYASRTLFFLTEDGTLRPIAIELTRPKSPNTPQW
RQVFTPGSSVAASWLWQLAKTHVLAHDTGYHQLVSHWLRTHCCVEPYVIAANRRLSQMHP
IYRLLHPHFRFTMEINAQARGMLINANGIIESAFAPGKLCMELSSAVYDKFWRFDMEALP
ADLIRRGMAIECEDGKLELTIEDYPYANDGLLIWDSIKEWVSDYVNHYYQLASDIHMDKE
LQGWWNEVRTKGHPDKEEGWPELNCHGSLVEVLTTIIWVASGHHAAVNFGQYPYAGYFPN
RPTIARRNMPTEGQACSHDGMQPTFVEDPVRVLLDTFPSQYQTTLVLPVLNLLSSHSPGE
EYMGTHAESAWMADREVRAAFGRFNERMMSIAEMIDCRNKDPERKNRQGPGVVPYVLLKP
SYGDPKDMTSVMEMGIPNSISI
NT seq 2769 nt   +upstreamnt  +downstreamnt
atgctcacggccacgcagactctggcgccggcagtgctctcccggagccatggcgcccct
tcttccttctccagccagccgcgccgcaccgccgccgccgcctcgagagtaagctgcacc
cgcgtcggcgccttgtcggaggtcgtcaatggcgaactcgtcgtcggcgaccaagaacag
acgaccgacgacctccttacgcggcacaagaatgtcgtcgccgactacacgctgagcgcc
acggtgacggtgagcttgaagcaggacgattccactccccagaaggtggcggacatggtt
aatcgagactggcttttccttgatttcttcagctcgcatatagaggggatgcacacggag
cctcagctcgccaggtactcgcacatggatggcaaaggctccttcatatacgaggccagc
ttcagcatcccgtcctcgttggacgccgtcggcgccgtgcaggtcgtgaaccgctacagc
agcgaggtgtacatctcggacatcgacgtccacctctgcggcggccgccatcagtggacc
gacatcactttccactgcaactcttggatcgactacaaccccaacgaccagcgcttcttc
ttccctctcaagtcgtacctcccgtctcagacgcccaggggcgtgaagaatctgcgcaag
gaagagctcagggccatccgcggcgatggccgcggcgagcgcaaggagtgggagcgcatc
tacgactacgacgtctacaacgacctcggcgaccccgacaatgacccggccactcgtcgg
ccggtgctcggcggccgcgggcgcccctacccgcgccgctgccgcacgggccgccgccgc
tgcaggacagacccgtcgtcggagtcgccgccggccaaggacggcgccgggatctacgtg
ccacgggacgaggcgttcacggagcggaaggccggcgcgttcgccaccaagaaggcgctg
tcggcgctgtcggcgttcaccacggcgcagagggtgtccggcgaccggcggcggggcttc
ccgtcgctggcggccatcgacgcgctgtacgaggacgggtacaagaaccggccgtcgtcg
tcgcagcaggaggcggacaacctcgaaggctacttcagggaggtgctccagaagcaggtg
aagctgctgctcaagggcgagaaggaggagttcaaggaggagctacgcaaagtgttcaaa
ttccaaacgcccgagattcacgacaaggacaagcttgcatggttcagagacgaggagttc
gcgcggcaaacgctggcagggatgaaccctctcagcatccaacttgtcagggacacggac
ttccctatattcagcaagctggacgaggaaacctacggcccaggggactccctcatcacc
aaagagctgattgaagagcagattaatggggtcatgacagcagaggaggccgtggagaag
aagaagctgttcatgctggactaccacgacgtgctcctgccgttcgtgcacgcggtgcgc
gagctggacgacaccacgctgtacgcctcgcggacgctcttcttcctgacggaggacggc
acgctgaggccgatcgccatcgagctgacgaggcccaagtcccccaacacgccgcagtgg
cgccaggtcttcacgccgggctccagcgtcgcggcgtcctggctgtggcagctcgccaaa
acgcacgtcctcgcccacgacaccggctaccaccagctcgtcagccactggctgaggacg
cactgctgcgtggagccgtacgtgatcgcggcgaaccggcggctgagccagatgcacccc
atctaccgactgctgcacccgcacttccgcttcaccatggagatcaacgcccaagcgcgc
gggatgctcatcaacgccaatggaatcatcgagagcgccttcgcgccggggaagctctgc
atggagctcagctcggcggtttacgacaagttttggaggttcgacatggaggctctgccc
gccgatctcatccggaggggcatggcgatcgaatgcgaggatggcaagctggagctgacg
atagaggactacccgtacgccaacgacggcctgctcatctgggactccatcaaggagtgg
gtgtcggattatgtgaaccattactaccagttggcttcagacatccacatggacaaggag
ctccagggttggtggaacgaggtgcgaaccaagggccacccggacaaggaggaagggtgg
ccagagctgaactgccacgggagcctcgtcgaggttctgaccaccatcatctgggtcgcg
tcggggcaccatgcggcggtgaactttggccagtacccctacgccggctacttccccaat
cgccccaccatcgcccggcggaacatgccgacggaggggcaggcgtgcagtcacgacggc
atgcagccaacgttcgttgaggatcccgtcagggtgctactagacacgttcccatcgcag
taccagaccaccctcgtcctgccggtgctcaacctgctatcgtcacactcgcccggcgag
gagtacatgggcacgcatgcggagtcagcgtggatggcggacagggaggtcagggcggcg
ttcgggaggttcaacgagaggatgatgagcatcgcggagatgatcgactgccggaacaag
gatccggagcgaaagaaccggcagggccccggcgtggtgccgtacgtgctgctcaagccg
tcctacggtgaccctaaggacatgacgtccgtgatggagatgggtatccccaacagcatc
tcaatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352509
Entry
4352509           CDS       T01015                                 
Name
(RefSeq) lipoxygenase 2.1, chloroplastic
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    4352509
   00592 alpha-Linolenic acid metabolism
    4352509
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     4352509
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 4352509
NCBI-ProteinID: XP_015618866
LinkDB
Position
12:22919882..22936833
AA seq 853 aa
MQVQGITTVTATVAVRLKEGISTPEKVANMVNRNWLFLDFFSSSTERHTEPQPAKYLRMD
DVTGSFIYESSFGVRSSFGAIGAVDVVNRFNTEVYISDIEVHLHGGHHHSSAVTFQCNSW
IACNNPDDRRFFFPLKSSYLPSQTPRGVKNLRKEELKAIRGNGRGERKEWERVYDYDVYN
DLGDPDNDPATRRPVLGGRERPYPRRCRTGRHRCRADPSSESPPATADGIYVPRDEAFTE
RRAGAFATKRALSMLSAFTTARRVSGDRRRSFPSLAAIDALYEDGYKNRPPSSQPEAVDV
DGYLAGMVQRQVKLLLKGEEEEFKEELRKLFKFQTPEIHDKDKLAWLRDEEFARKTLAGM
NPLSIQLVRDTEFPIFSKLDEETYGPGDSLITKELIEEQINGVMTAEEAVEKKKLFMLDY
HDVLLPFVHAVRELDDTTLYASRTLFFLTEDGTLRPIAIELTRPKSPNTPQWRQVFTPGS
SVAASWLWQLAKTHVLAHDTGYHQLVSHWLRTHCCVEPYVIAANRRLSQMHPIYRLLHPH
FRFTMEINAQARGMLINANGIIESAFAPGKLCMELSSAVYDKFWRFDMEALPADLIRRGM
AFHGEDGKLKLTIEDYPYANDGLLVWDSIKEWVSDHVNHYYPSASDIYSDEELHGWWNEV
QTNGHPDKKDGWPELDCHGSLIKVLTTIIWVASGHHAAVNFGQYPYAGYFPNRPTIARRN
MPTEEEHGCEGMQPTFVEDPVRVLLDTFPSQYQTTLILPALNLLSSHSPSEEYMGTHTEA
AWMANREVRAAFGRFNERMMRIAETIDRRNRDPERRNRWGPGVVPYVLLKPCYGDPKDMS
SVMEMGIPNSISI
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgcaggtacagggcataaccacggtgacggccactgtggcggtgcgcttgaaagagggg
atatccactcccgagaaggtggccaacatggttaaccgaaactggcttttccttgatttc
tttagctcgagtacagagaggcacacggagccccaaccagcaaaatacctgcgcatggac
gacgtcaccggctccttcatatatgagtctagcttcggcgttcgatcatcattcggcgcc
atcggtgccgtcgatgtcgtcaaccgcttcaacaccgaggtgtatatctcggacatcgag
gtccacctccatggcggccaccatcactcgagcgccgtcaccttccaatgcaactcgtgg
atcgcctgcaacaaccccgacgatcgccgcttcttcttccctctcaagtcgtcatacctc
ccgtctcagacgcccaggggagtgaagaatctgcgcaaggaagagctcaaggccatccgc
ggcaatggccgcggcgagcgcaaggagtgggagcgcgtctacgactacgatgtctacaac
gacctcggcgaccccgacaatgacccggccactcgtcggccggtgctcggcggccgtgag
cgcccctacccacgccgctgccgcacgggccgccaccgctgcagggcggacccgtcgtcg
gagtcgccgccggccaccgccgacgggatctacgtgccacgcgacgaggcgttcacggag
cggagggccggcgcgttcgccaccaagagggcgctgtcgatgctgtcggcgttcaccacg
gcgcggagggtgtccggcgaccggcggcggagcttcccgtcgctggcggcgatcgacgcg
ctgtacgaggacgggtacaagaaccggccgccgtcgtcgcagccggaggcggtcgacgtc
gacggctacctcgccggcatggtccagaggcaggtgaagctgttgctcaagggcgaggag
gaggagttcaaggaggagctacgcaaattgttcaagttccaaacgcccgagattcacgac
aaggacaagcttgcatggttgagagacgaggagttcgcgcggaaaacgctggcagggatg
aaccctctcagcatccaacttgtcagggacacggagttccctatattcagcaagctggac
gaggaaacctacggcccaggggactccctcatcaccaaagagctgattgaagagcagatt
aatggggtcatgacagcagaggaggccgtggagaagaagaagctgttcatgctggactac
cacgacgtgctcctgccgttcgtgcacgcggtgcgcgagctggacgacaccacgctgtac
gcctcgcggacgctcttcttcctgacggaggacggcacgctgaggccgatcgccatcgag
ctgacgaggcccaagtcccccaacacgccgcagtggcgccaggtcttcacgccgggctcc
agcgtcgcggcgtcctggctgtggcagctcgccaaaacgcacgtcctcgcccacgacacc
ggctaccaccagctcgtcagccactggctgaggacgcactgctgcgtggagccgtacgtg
atcgcggcgaaccggcggctgagccagatgcaccccatctaccggctgctgcacccgcac
ttccgcttcaccatggagatcaacgcccaagcgcgcgggatgctcatcaacgccaatgga
atcatcgagagcgccttcgcgccggggaagctctgcatggagctcagctcggcggtttac
gacaagttttggaggttcgacatggaggctctgcccgccgatctcatccggaggggaatg
gcattccatggggaggatggcaagctgaagctaacgatagaggactacccgtatgccaac
gacggcctgctcgtctgggactctatcaaggagtgggtgtcagaccatgtgaaccattac
tacccgtcagcgtcggacatttactctgatgaggagctccatggttggtggaacgaggtg
caaacgaatggccacccggacaagaaggacggatggccagagctggactgccatgggagc
ctcatcaaggtcctgaccaccattatttgggtcgcatcggggcaccacgcagcggtgaac
ttcggccagtacccctacgccggctacttccccaaccgtcccaccatcgcgcggcgaaac
atgccgacggaggaggagcacgggtgcgagggcatgcaaccgacattcgttgaggatcct
gtcagggttttgctggacacgttcccgtcgcagtaccagactaccctcatcttgccagcg
ctcaacctgttgtcgtcgcactcgccaagcgaggagtacatgggcacgcacacggaggcg
gcgtggatggcaaacagggaggtgagggcggcgttcgggaggttcaacgagaggatgatg
aggatcgcggagacgatcgaccgccggaacagggatccggagcggaggaaccggtggggc
cctggtgtggtgccatatgtgctgctaaagccgtgctatggtgaccccaaggacatgtcg
tcggtgatggagatgggcatccccaacagcatctccatttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267158
Entry
9267158           CDS       T01015                                 
Name
(RefSeq) putative lipoxygenase 5
  KO
K00454  lipoxygenase [EC:1.13.11.12]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00591  Linoleic acid metabolism
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    9267158
   00592 alpha-Linolenic acid metabolism
    9267158
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.12  linoleate 13S-lipoxygenase
     9267158
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 9267158
NCBI-ProteinID: XP_015637182
LinkDB
Position
4:22304767..22309335
AA seq 922 aa
MASLELLGRRMSSCSWGGGSAAAMRGGAGMCFASMEAAGSRGMGKGASRRRTARSTAPVG
ALVERVVVAPAPVEQQRGAGRPEAHPQSVAARAVVTVRRRRKEDAKDRFAEQLDALADRV
GRSVLLELVSTETDPRKGTPKKSKPSALVGWFDKKDVKAERVVYTAEFAVDAGFGEPGAV
TVLNRHQREFYIESIVVEGFPTGPAHFTCNSWVQPTRVSRDRRVFFSNRPYLPSETPPGL
RELRLRELADLRGDGTGERRITDRVYDYDVYNDLGNPDKGVASARPVLGGEQMPYPRRMR
TGRPSTATDASAESRVEYPEPIYVSRDEEFEEGKNEMLSEGAIKALLHNFMPLLVSSVSP
DIRDFAGFHDVDNLFKEGLRLKQALHDQLFQKIPFVRKIQENSEGLLRYDTPDIIKKDKF
AWLRDDEFARQALAGINPVNIERLQAFPPVSKLDPAVYGPPESAITEEHIIGHLDGMSVQ
EAVEGSRLYMLDYHDIFLPFLDRINAQDGRKAYGTRAVFFLTAAGTLKPIAIELCLPPMT
DGCKRAKRVFTPPADATSNWLWQLAKAHVCSNDAGVHQLINHWLRTHACMEPFIIAAHRQ
MSAMHPIFKLLKPHMRYTLKINALARQILINGDGVIESGFTPGNVCMEMSAFAYRELWRL
DQEGLPADLIRRGMAVEDPSQPHGLRLLIEDYPYAADGLLLWSAISRWCEAYVAAYYPSD
EAVQADYELQSWYAEAVQSGHADKRGAPWWPRLSTPGDLASLLTTLVWLCSAQHAALNFG
QYPLGGYIPNRPPLMRRLVPAEGDPEYAHLVADPHRFFLSALPSLTQTTTFMTVIDTLST
HSADEEYLGERPDEAWTADPAALAAAREFAADVRRAEEEIERRNADPSRRNRCGAGVLPY
ELMAPSSGPGITCRGVPNSVTI
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggcgtcgttggagttgctggggaggaggatgtcgtcgtgctcgtggggagggggatcg
gcggcggcgatgaggggaggggcggggatgtgtttcgcgagcatggaggcggcggggagc
agggggatggggaagggggcgagtaggaggaggacggcgaggtcgacggcgccggtgggc
gcgctggtggagcgggtggtggtggcgccggcgccggtggagcagcagcgcggggcgggg
cggccggaggcgcacccgcagagcgtggcggccagggccgtggtgaccgtgcggcggagg
cgcaaggaggacgccaaggaccgcttcgccgagcagctcgacgccctcgccgacagggtc
ggccgcagcgtcctcctcgagctcgtcagcacggagaccgacccaaggaaggggacgccg
aagaagagcaagccgtcggcgctggtggggtggttcgacaagaaggacgtcaaggcggag
cgcgtggtgtacacggcggagttcgccgtcgacgccgggttcggcgagccgggcgcggtg
accgtgctcaaccgccaccagcgggagttctacatcgagagcatcgtcgtcgaggggttc
ccgaccggcccggcgcacttcacctgcaactcgtgggtgcagcccacgcgcgtgagccgc
gaccggcgcgtgttcttcagcaaccggccgtacctgccgtcggagacgccgccggggctg
agggagctccggctccgggagctcgccgacctccgcggcgacggcaccggcgagcggagg
atcaccgaccgggtgtacgactacgacgtgtacaacgacctgggcaacccggacaagggc
gtcgcctccgcccgccccgtcctcggcggcgagcagatgccgtacccgcggcggatgcgc
accggccgtcccagcaccgccacagacgcgagcgcggagagcagggtggagtacccggag
cccatctacgtgtcgcgggacgaggagttcgaggagggcaagaacgagatgctgtcggag
ggcgcgatcaaggcgctgctccacaacttcatgccgctgctcgtctcctccgtctcgccg
gacatccgcgacttcgccggcttccacgacgtcgacaacctcttcaaggagggcctccgc
ctcaagcaggcgctccacgaccagctcttccagaagatccccttcgtccgcaagatccag
gagaacagcgagggcctcctccgctacgacacccccgacatcatcaagaaggacaagttc
gcgtggctgcgtgacgacgagttcgcgaggcaggcgcttgccggcatcaaccccgtcaac
atcgagcgtctccaggcgttcccgccggtgagcaagctcgacccggccgtgtacggcccg
ccggagtcggcgatcacggaggagcacatcatcgggcacctcgacggcatgtcggtgcag
gaggcggtggaggggagcaggctgtacatgctggattaccacgacatcttcctcccgttc
ctggacaggatcaacgcccaggacggccggaaggcgtacggcacgcgcgcggtcttcttc
ctgacggccgccggcacgctgaagccgatcgccatcgagctgtgcctgccgccgatgaca
gacggctgcaagcgcgccaagcgggtgttcacgccgccggccgacgccaccagcaactgg
ctgtggcagctcgccaaggcacacgtctgctccaacgacgccggtgttcaccagctcatc
aaccactggttgaggacgcacgcgtgcatggagccgttcatcatcgcggcgcaccggcag
atgagcgcgatgcaccccatcttcaagctgctcaagccgcacatgcggtacacgctcaag
atcaacgcgctggcgcggcagatcctcatcaatggcgacggcgtcatcgagtcgggcttc
acacccggcaacgtctgcatggagatgagcgccttcgcctaccgggaactatggcggctg
gaccaggagggcctccccgccgacctcatccgaagaggcatggccgtggaggacccgagc
cagccgcacgggctacggctgctcatcgaggactacccgtacgccgccgacgggctgctc
ctctggtcggcgatctcgcggtggtgcgaggcgtacgtggcggcctactacccgagcgac
gaggccgtgcaggcggactacgagctgcagtcgtggtacgccgaggccgtgcagagcggg
cacgcggacaagcgcggcgcgccgtggtggccgcgcctctcgacgcccggcgacctggcc
tccctgctcaccaccctggtgtggctctgctcggcgcagcacgcggcgctcaacttcggg
cagtacccgctcggtggctacatcccgaaccgcccgccgctgatgcgccgcctggtgccc
gccgagggcgacccagagtacgcgcacctcgtcgccgacccgcaccgcttcttcctctcg
gcgctgcccagcctgacgcagaccacgacgttcatgaccgtcatcgacacgctgtccacg
cactccgccgacgaggagtacctcggggagcgccccgacgaggcgtggacggccgacccg
gcggcgctggcggccgcgcgggagttcgcggccgacgtgcgccgcgccgaggaggagatc
gagcggcgcaatgccgacccctcccggcgcaaccgttgcggcgccggcgtgctgccgtac
gagctgatggcgccgtcgtccggaccgggcatcacctgccggggcgtgccaaacagcgta
actatatag

DBGET integrated database retrieval system