KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328662
Entry
4328662           CDS       T01015                                 
Name
(RefSeq) transcription factor HY5
  KO
K16241  transcription factor HY5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4328662
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4328662
Transcription factors [BR:osa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant bZIP factors
    4328662
SSDB
Motif
Pfam: bZIP_1 bZIP_2 GAS TSC22 bZIP_Maf DMPK_coil DUF3563 Macoilin FlaC_arch YabA Uso1_p115_C EMP24_GP25L Phlebovirus_NSM ATF7IP_BD
Other DBs
NCBI-GeneID: 4328662
NCBI-ProteinID: XP_015623711
UniProt: A0A0P0VG62
LinkDB
Position
2:complement(5760616..5763140)
AA seq 199 aa
MLHASSKDERRGQSGEAEAEASGGVHANPSSPARMQEQATSSRPSSSERSSSSGGHHMEI
KEGMESDEEIGRVPELGLEPGGASTSGRAAGGGGGGAERAQSSTAQASARRRGRSPADKE
HKRLKRLLRNRVSAQQARERKKAYLNDLEVKVKDLEKKNSELEERFSTLQNENQMLRQIL
KNTTVSRRGPGSTASGEGQ
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcttcacgcaagcagcaaggacgagaggagaggacagagtggggaagctgaagctgaa
gcaagcggaggagtgcacgcgaatccctcctcgccggcgagaatgcaggagcaggcgacg
agctcgcggccgtccagctccgagaggtcgtccagctccggcggccaccacatggagatc
aaggaaggaatggagagcgacgaggagatagggagagtgccggagctggggctggagccg
ggcggcgcttcgacgtcggggagggcggccggcggcggcggcggcggggcggagcgcgcg
cagtcgtcgacggcgcaggccagcgcgcgccgccgcgggcgcagccccgcggataaggag
cacaagcgcctcaaaaggttgctgaggaaccgggtatcagcgcagcaggcaagggagaga
aagaaggcatacttgaatgatcttgaggtgaaggtgaaggacttggagaagaagaactca
gagttggaagaaagattctccaccctacagaatgagaaccagatgctcagacagatactg
aagaatacaactgtgagcagaagagggccaggtagcactgctagtggagagggtcaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268301
Entry
9268301           CDS       T01015                                 
Name
(RefSeq) transcription factor HY5 isoform X1
  KO
K16241  transcription factor HY5
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    9268301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    9268301
Transcription factors [BR:osa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   Plant bZIP factors
    9268301
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Myosin_tail_1 Phlebovirus_NSM CCDC144C GIT_CC Saf4_Yju2 UPF0242 ATF7IP_BD GAS Macoilin TSC22 DUF1192 FmiP_Thoc5 Med9 CASP_C CENP-F_leu_zip FlaC_arch YabA Ax_dynein_light Sas6_CC SR-25
Other DBs
NCBI-GeneID: 9268301
NCBI-ProteinID: XP_015641260
LinkDB
Position
6:23772961..23776897
AA seq 183 aa
MQRDHRRSSPPAAASSSERSSDSAPNTDDGKEGVDSDDEEIVGRVPEFGLALPGTSTSGR
GSVRVAGDAAATAAGTSSSSPAAQAGVAGSSSSGRRRGRSPADKEHRRLKRLLRNRVSAQ
QARERKKAYMSELEARVKDLERSNSELEERLSTLQNENQMLRQVLKNTTANRRGPDSSAG
GDS
NT seq 552 nt   +upstreamnt  +downstreamnt
atgcaacgagatcaccggaggagctcgccgccggcggccgcctccagcagcgagaggtcg
tcggactccgccccaaacaccgacgacggcaaggaaggggtggatagcgacgacgaggag
atagtagggagggtgccggagttcgggctggcgctgccggggacgtcgacgtcgggcaga
ggtagtgttcgggttgcaggtgacgcggcggcgacggcggccgggacgtcgtcgtcgtcg
cccgcggcgcaggccggcgtcgccggcagcagcagcagcgggcgccgccgcggacgcagc
cccgccgacaaggagcaccggcgcctcaaaagattgctgaggaaccgggtgtcagcgcag
caggctcgggagaggaagaaggcgtacatgagtgagctggaggcgagggtgaaggacctg
gagaggagcaactcagagctggaggagaggctctctaccctgcaaaacgagaaccagatg
cttaggcaggtgctgaagaacacaacagcaaacagaagagggccagacagcagtgccggc
ggagacagctag

DBGET integrated database retrieval system