KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328742
Entry
4328742           CDS       T01015                                 
Name
(RefSeq) allene oxide synthase 3
  KO
K01723  hydroperoxide dehydratase [EC:4.2.1.92]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4328742
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4328742
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.92  hydroperoxide dehydratase
     4328742
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP74 family
   4328742
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4328742
NCBI-ProteinID: XP_015624763
UniProt: Q6Z6L1
LinkDB
Position
2:6628382..6630880
AA seq 500 aa
MAPPPVNSGDAAAAATGEKSKLSPSGLPIREIPGGYGVPFFSPLRDRLDYFYFQGAEEYF
RSRVARHGGATVLRVNMPPGPFISGNPRVVALLDARSFRVLLDDSMVDKADTLDGTYMPS
RALFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAMFDAVEAGLGAA
VEFNKLNMRYMLDFTCAALFGGEPPSKVVGDGAVTKAMAWLAFQLHPIASKVVKPWPLEE
LLLHTFSLPPFLVRRGYADLKAYFADAAAAVLDDAEKSHTGIPRDELLDNLVFVAIFNAF
GGFKIFLPHIVKWLARAGPELHAKLATEVRATVPTGEDDGITLAAVERMPLVKSVVWEAL
RMNPPVEFQYGHARRDMVVESHDAAYEVRKGEMLFGYQPLATRDEKVFDRAGEFVADRFV
AGGAAGDRPLLEHVVWSNGPETRAPSEGNKQCPGKDMVVAVGRLMVAELFRRYDTFAADV
VEAPVEPVVTFTSLTRASSG
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcgccaccgccagtgaactccggcgacgccgccgccgccgccacgggagagaagagc
aagctctcgccgtcgggcctccccatacgcgagatacccggcggctacggcgtgcccttc
ttctcgccgctgcgcgaccgcctcgactacttctacttccagggcgccgaggagtacttc
cgatcacgcgtcgcccgccacggcggcgccaccgtgctccgcgtcaacatgccgcccggc
cccttcatctccggcaacccccgcgtcgtcgccctcctcgacgcgcgcagcttccgcgtc
ctcctcgacgactccatggtggacaaggccgacacgctcgacggcacctacatgccgtcg
cgcgcgctcttcggcggccaccgcccgctcgccttcctcgacgccgccgacccgcgccac
gccaagatcaagcgcgtcgtgatgtcgctcgccgccgcgcggatgcaccacgtcgcgccg
gcgttccgcgccgcctttgccgccatgttcgacgccgtcgaggccggcctcggcgccgcc
gtcgagttcaacaagctcaacatgaggtacatgctcgacttcacctgcgccgcgctgttc
ggcggcgagccgccgagcaaggtggtcggcgacggcgccgtgacgaaggccatggcgtgg
ctcgcgttccagctgcacccgatcgcgagcaaggtcgtcaagccatggccgctcgaggag
ctactcctgcacaccttctccctgccgccgttcctggtgcggcgtggctacgccgacctg
aaggcgtacttcgccgacgccgccgcggccgtcctcgacgacgccgagaagagccacacg
ggaatcccgcgcgacgagctcctcgacaaccttgtgttcgtcgccattttcaacgccttc
ggcggcttcaagatcttcctgccacacatcgtcaagtggctcgcccgcgccggcccggag
ctccacgccaagcttgccaccgaggtccgcgccaccgtgcccaccggcgaggacgacggc
atcaccctcgccgccgtcgagcggatgccgctggtgaagtcggtggtgtgggaggcgctg
cgcatgaacccgccggtggagttccagtacggccacgcgcggcgcgacatggtggtcgag
agccacgacgcggcgtacgaggtgcgcaagggggagatgctgttcggctaccagccgctc
gccacccgcgacgagaaggtgttcgaccgcgccggcgagttcgtcgccgaccggttcgtc
gccggcggcgccgccggcgaccggccgctgctggagcacgtggtgtggtcgaacgggccg
gagacgagggcgccatcggaggggaacaagcagtgccccgggaaggacatggtggtggcg
gtggggcggctgatggtggcggagctgttccggcggtacgacacgttcgccgccgacgtg
gtggaggcgccggtggagccggtggtgacgttcacgtcgctgacacgggcgtcgtcggga
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328743
Entry
4328743           CDS       T01015                                 
Name
(RefSeq) allene oxide synthase 4
  KO
K01723  hydroperoxide dehydratase [EC:4.2.1.92]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4328743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4328743
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.92  hydroperoxide dehydratase
     4328743
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP74 family
   4328743
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4328743
NCBI-ProteinID: XP_015623380
UniProt: Q6Z6K9
LinkDB
Position
2:6637944..6639841
AA seq 510 aa
MAPPRANSGDGNDGAVGGQSKLSPSGLLIREIPGGYGVPFLSPLRDRLDYYYFQGADEFF
RSRVARHGGATVLRVNMPPGPFLAGDPRVVALLDARSFRVLLDDSMVDKADTLDGTFMPS
LALFGGHRPLAFLDAADPRHAKIKRVVMSLAAARMHHVAPAFRAAFAAMFDEVDAGLVAG
GPVEFNKLNMRYMLDFTCAALFGGAPPSKAMGDAAVTKAVKWLIFQLHPLASKVVKPWPL
EDLLLHTFRLPPFLVRREYGEITAYFAAAAAAILDDAEKNHPGIPRDELLHNLVFVAVFN
AYGGFKIFLPHIVKWLARAGPELHAKLASEVRAAAPAGGGEITISAVEKEMPLVKSVVWE
ALRMNPPVEFQYGRARRDMVVESHDAAYEVRKGELLFGYQPLATRDEKVFDRAGEFVPDR
FVSGAGSAARPLLEHVVWSNGPETGTPSEGNKQCPGKDMVVAVGRLMVAGLFRRYDTFAA
DVEELPLEPVVTFTSLTRAADGDGAARRGV
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcgccgccgcgagccaactccggcgacggtaacgacggcgccgtcggagggcagagc
aagctctcgccgtcgggcctgctgatacgcgagattccgggcggctacggcgtgcccttc
ctctcgccgctgcgcgaccgcctcgactactattacttccagggcgccgacgagttcttc
cgctcacgcgtcgcccgccacggcggcgccaccgtgctccgcgtcaacatgccgcccggc
cccttcctcgccggcgacccccgcgtcgtcgccctcctcgacgcgcgcagcttccgcgtc
ctcctcgacgactccatggtggacaaggccgacacgctcgacggcaccttcatgccgtcg
ctcgcgctcttcggcggccaccgcccgctcgccttcctcgacgccgccgaccctcgccac
gccaagatcaagcgcgtcgtgatgtcgctcgccgcggcgaggatgcaccacgtcgcgccg
gcgttccgcgccgccttcgccgccatgttcgacgaggtcgacgccggcctcgtcgccggc
ggccccgtcgagttcaacaagctcaacatgcggtacatgctcgacttcacctgcgccgcg
ctgttcggcggcgcgccgccgagcaaggccatgggcgacgctgccgtgacgaaggcggtg
aagtggctcatcttccagcttcacccgctcgccagcaaggtcgtcaagccgtggccgctg
gaggacctcctcctccacaccttccgcctgccgccgttcctggtgcgccgcgagtacggc
gagatcacggcgtacttcgccgccgccgccgcggccatcctcgacgacgccgagaagaac
cacccgggaatcccgcgcgacgagctcctccacaacctcgtgttcgtcgccgtcttcaac
gcctacggcggcttcaagatcttcctgccacacatcgtcaagtggctcgcccgcgccggc
ccggagctccacgccaagctagcctccgaggtccgcgccgccgcgcccgccggcggcggc
gagatcaccatctccgccgtggagaaggagatgccgctggtgaagtcggtggtgtgggag
gcgctgcgcatgaacccgccggtggagttccagtacgggcgcgcgcggcgcgacatggtc
gtcgagagccacgacgcggcgtacgaggtccgcaagggggagctgctgttcgggtaccag
ccgctcgccacccgcgacgagaaggtgttcgaccgcgccggcgagttcgtccccgaccgg
ttcgtctccggcgccggaagcgccgcccggccgctgctggagcacgtggtgtggtcgaac
gggccggagaccgggacgccatcggaggggaacaagcagtgccccgggaaggacatggtg
gtggcggtggggcggctgatggtggcggggctgttccggcggtacgacacgttcgccgcc
gacgtggaggagctgccgcttgagccggtggtcacgttcacgtcgctgacccgcgccgcc
gacggcgacggcgccgcgcggcgcggagtataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332121
Entry
4332121           CDS       T01015                                 
Name
(RefSeq) allene oxide synthase 2
  KO
K01723  hydroperoxide dehydratase [EC:4.2.1.92]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4332121
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4332121
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.92  hydroperoxide dehydratase
     4332121
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP74 family
   4332121
SSDB
Motif
Pfam: p450 P5CR_dimer
Other DBs
NCBI-GeneID: 4332121
NCBI-ProteinID: XP_015628763
UniProt: Q7XYS3
LinkDB
Position
3:6608582..6610595
AA seq 478 aa
MELGVPLPRRPVPGSYGVPFVSAVRDRLDFYYLQGQDKYFESRAERYGSTVVRINVPPGP
FMARDPRVVALLDAKSFPVLFDVAKVEKRDVFTGTFMPSTSLTGGYRVCAYLDPSEPNHA
KIKQLLLSLLVSRKDAFVPVFRSNFGALLDTVESQLASGGGKSDFTALNDATSFEFIGEA
YFGVRPSASSSLGTGGPTKAALWLLWQLAPLTTLGLPMIIEDPLLHTLPLPPFLISSDYK
ALYAYFAAAASQALDAAEGLGLSREEACHNLLFATVFNSYGGFKLLLPQILSRVAQAGEK
LHERLAAEIRSAVADAGGNVTLAALEKMELTRSVVWEALRLDPPVRFQYGRAKADLEIES
HDASFAIKKGEMLFGYQPCATRDPRVFGATAREFVGDRFVGEEGRKLLQYVYWSNGRETE
NPSVDNKQCPGKNLVVLVGRLLLVELFLRYDTFTAEAGKKVVITGVTKASTSAVNRTA
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggagctaggcgtgccactgccacgacggcccgtgcccggtagctacggcgtgccgttc
gtctcggcggtgcgcgaccgcctcgatttctactacttgcaggggcaggacaagtacttc
gagtcgcgcgccgagaggtacggctccaccgtcgtccgcatcaacgtcccgcctggccca
ttcatggcgcgcgacccccgcgtggtggcgctcctcgacgccaagagcttccccgtcctc
ttcgacgtcgccaaggtcgagaagcgggacgtgttcaccggcacgttcatgccgtccacc
tccctcaccggcggctaccgcgtctgcgcctacctcgacccgtccgagcccaaccacgcc
aagatcaagcagctgctcctctccctcctggtctctcgcaaggacgccttcgtcccggtc
ttccgctccaacttcggcgcgctcctcgacaccgtcgagtcgcagctcgcgagcggcggc
ggcaagtccgacttcaccgccctcaacgatgccacctccttcgagttcatcggcgaggcg
tacttcggcgtgcgtccctccgcgtcgagctccctcggcaccggcgggccgaccaaggcc
gccctgtggctcctatggcagctcgccccgctcaccacgctcggcctgcccatgatcatc
gaggatccgctcctccacacgctgccgctgccacccttcctcatcagctccgactacaag
gcgctgtacgcgtacttcgccgccgcggcgtcgcaggcgctcgacgccgccgagggcctt
ggcctgtcgcgggaggaggcctgccacaacctgctgttcgcgacggtgttcaacagctac
ggcggcttcaagctgctgctcccgcagatcctgtcgcgcgtcgcgcaggccggcgagaag
ctccacgagaggctcgccgcggagatacggagcgcggtggccgacgccggcggcaacgtg
acgctggccgctctggagaagatggagctgaccaggtcggtggtgtgggaggcgctgcgg
ctggacccgccggtcaggttccagtacgggcgcgccaaggccgacctggagatcgagagc
cacgacgcgtcgttcgcgatcaagaagggggagatgctgttcggctaccagccgtgcgcc
accagggacccgcgggtgttcggcgccacggcgagggagttcgtcggcgaccggttcgtc
ggcgaggaggggaggaagctgctgcaatacgtgtactggtcgaatgggcgagagacggag
aaccctagcgttgacaacaagcagtgccccggcaagaacctggtggtgctcgtcggaagg
ctgttgctcgtcgagctcttcctccggtacgacaccttcaccgccgaggccggcaaaaag
gtggtcatcaccggggtcaccaaagcttcaacctccgccgtcaatcgtactgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334233
Entry
4334233           CDS       T01015                                 
Name
(RefSeq) allene oxide synthase 1, chloroplastic
  KO
K01723  hydroperoxide dehydratase [EC:4.2.1.92]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00592  alpha-Linolenic acid metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Module
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    4334233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4334233
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.92  hydroperoxide dehydratase
     4334233
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP74 family
   4334233
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4334233
NCBI-ProteinID: XP_015631686
UniProt: Q7Y0C8 Q10EK5 Q0DN88
LinkDB
Position
3:complement(31765035..31767095)
AA seq 512 aa
MATAAACISFASPSPARVVIRRQTRASASASATDRQEVVSPKRRLPLRKVPGDYGPPVVG
AIRDRYEYFYGPGGRDGFFAARVRAHRSTVVRLNMPPGPFVARDPRVVALLDAASFPVLF
DTSLVDKTDLFTGTFMPSTDLTGGYRVLSYLDPSEPNHAPLKTLLFYLLSHRRQQVIPKF
REVYGDLFGLMENDLARVGKADFGVHNDAAAFGFLCQGLLGRDPAKSALGRDGPKLITKW
VLFQLSPLLSLGLPTLVEDTLLHSLRLPPALVKKDYDRLADFFRDAAKAVVDEGERLGIA
REEAVHNILFALCFNSFGGMKILFPTLVKWLGRAGARVHGRLATEVRGAVRDNGGEVTMK
ALAEMPLVKSAVYEALRIEPPVAMQYGRAKRDMVVESHDYGYEVREGEMLFGYQPMATKD
PRVFARPEEYVPDRFLGEDGARLLRHVVWSNGPETAAPTLHDKQCAGKDFVVLVARLLLV
ELFLRYDSFDVEVGTSTLGSSVTVTSLKKATF
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccacggcggcggcttgcatctcgttcgcgtcgccgtcgccggcgcgcgtcgtgatc
aggcggcagacgcgggcgtcggcgtcggcgtcggcgacggaccggcaggaggtggtgtcg
ccgaagcggcggctgccgctgcggaaggtgccgggggactacggcccgccggtggtgggc
gcgatccgggacaggtacgagtacttctacggcccgggcggccgcgacggcttcttcgcg
gcgcgcgtccgcgcgcaccgctccacggtggtgcgcctcaacatgccgcccgggccgttc
gtggcgcgcgacccgcgggtggtggcgctgctcgacgccgcctccttccccgtcctgttc
gacacgtcgctcgtcgacaagaccgacctcttcaccggcaccttcatgccgtccaccgac
ctcaccggcgggtaccgcgtcctctcctaccttgacccctccgagcccaaccacgcgccg
ctcaagaccctcctcttctacctcctctcccaccggcggcagcaggtgatccccaagttc
cgcgaggtgtacggcgacctgttcggcctcatggagaacgacctcgcccgcgtcggcaag
gccgacttcggcgtccacaacgacgccgccgcgttcggcttcctctgccaggggctcctc
ggccgcgacccggccaagtcggcgctggggcgcgacgggcccaagctgatcaccaagtgg
gtgctgttccagctcagcccgctgctcagcctcggcctccccaccctcgtcgaggacacg
ctcctccactcgctccgcctcccgccggcgctggtgaagaaggactacgaccgcctcgcc
gacttcttccgggacgcggccaaggccgtcgtcgacgagggggagcgcctcggcattgca
cgggaggaggccgtgcacaacatcctcttcgcgctctgcttcaactcgttcggcgggatg
aagatcctgttcccgacgctggtgaagtggctgggccgcgccggggcgcgtgtgcacggg
cggctcgccaccgaggtgcgcggcgccgtgcgggacaacggcggggaggtgacgatgaag
gcgctggcggagatgccgctggtgaagtcggcggtgtacgaggcgctgcggatcgagccg
ccggtggcgatgcagtacgggagggcgaagcgggacatggtggtggagagccacgactac
gggtacgaggtgagggaaggggagatgctgttcgggtaccagcccatggcgaccaaggac
ccgcgggtgttcgcgcggccggaggagtacgtgccggacaggttcctcggcgaggacggc
gcgcggctgctccgccacgtcgtgtggtccaacgggcccgagacggcggcgcccaccctg
cacgacaagcagtgcgccggcaaggacttcgtcgtgctcgtcgcgcgcctcctcctcgtc
gagctcttcctccgatacgactccttcgacgtcgaggtcggcacctccacgctcggctca
tctgtcaccgtcacctcgctcaagaaggccaccttctga

DBGET integrated database retrieval system