KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328774
Entry
4328774           CDS       T01015                                 
Name
(RefSeq) peroxisomal nicotinamide adenine dinucleotide carrier
  KO
K13354  solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4328774
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4328774
Transporters [BR:osa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   4328774
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 4328774
NCBI-ProteinID: XP_015625735
LinkDB
Position
2:7018207..7024224
AA seq 443 aa
MQYPDFRRALTHNIASGRTLFGRAFSQKTHPHRPPLLRRIIFCRYLPSRCLLRSSRTSRG
LAAADLHLARRGEQIRAGWRMSSAAVNGLAGAGGGIIAQIITYPLQTVNTRQQTERSAKK
KKANGAAIANTSTLFQMLQLFQTEGWGGLYSGLKPSLIGTAASQGIYYYFYQILKNKVED
LAVARGKKGLGDGTVGMFSWLGIAAVAGSINVLLTNPIWVLVTRMQTHTQAEKKIMESKK
ELLLKDVARANSIEVSILKDRLYKLDSEKPRPYGTIQAVREVYRESGIRGFWKGLIPTLI
MVCNPSIQFMIYETLAKRLRSKRSGKELPKKNLTAMEVFLLGAIAKLGATVVTYPLLVVK
SRLQAKQEIGRNVMSRYTGTIDAIIKMIRYEGLHGFYKGMGTKIVQSVFAASVLFMVKEE
LVKFVVMLIARSRTVLGPSSKKR
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgcaatatccggattttagaagggcccttacgcacaacatcgcctcagggaggacactg
ttcggcagggccttttcgcaaaaaacccacccccatcgtccgccccttctgcgccgcata
atattttgccgatatctcccgtctcgttgtctcctccgctcctcaagaacgagtcgcggg
ctcgcggctgccgatctccatctggcgaggagaggagagcagatcagagcaggttggcgc
atgtcaagtgccgcagtgaatggattggctggtgccggtggtggcatcatcgcccagatc
atcacctaccccctccagaccgtgaacacccggcagcagacagagaggtcggcaaaaaag
aagaaggccaatggcgcagccatcgccaatacttccaccctcttccagatgcttcagctg
ttccaaacggaaggatggggagggttgtatagcggcctcaaaccctctcttattggcact
gctgcttcacagggaatctattactacttttaccagattctcaaaaacaaggtggaagat
ctagcagttgctcgcggtaagaagggtctaggggatggtaccgttgggatgttctcctgg
cttggtattgcagctgttgctgggtcaatcaatgttcttcttaccaatccaatatgggtt
ctcgtgactcgtatgcagacacatacgcaagcagaaaagaagatcatggagtctaaaaag
gagcttttgctgaaggatgttgctagggccaattcaatagaggtctcaattcttaaggat
aggttgtataaacttgattctgaaaagcctcgtccatatgggacaattcaagcggtccgg
gaggtctaccgtgaatcaggcataagaggattctggaaaggacttattccgacactaatt
atggtatgtaatccatcaatacaatttatgatctatgaaacattggcaaagcgtctccgg
tcaaagagatctggaaaggaactcccaaaaaagaaccttactgctatggaggtattctta
ttaggtgcaatagcaaagctcggagctactgttgtgacatacccattgctagtggttaag
tctaggttgcaagcaaaacaagaaattggcaggaatgtgatgtcaagatacacaggtacg
attgacgcgatcataaagatgatccggtatgaaggattgcacgggttttacaaaggaatg
ggtacgaagattgtacagagcgtctttgccgcctcagttctttttatggtaaaagaagag
ttggtaaaattcgtagttatgttaattgctaggagtaggaccgtgctcggtcctagctct
aagaaacgatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332347
Entry
4332347           CDS       T01015                                 
Name
(RefSeq) peroxisomal nicotinamide adenine dinucleotide carrier
  KO
K13354  solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4332347
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4332347
Transporters [BR:osa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   4332347
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 4332347
NCBI-ProteinID: XP_015628226
UniProt: A3AGC4 Q84QA9
LinkDB
Position
3:8749812..8752908
AA seq 344 aa
MSDALINGVAGAGGGIIAQLLTYPLQTVNARQQTERDPSKPAFKDGAVRQMCLVVKHEGW
ERLYGGLMPSLVGTAASQGVYYYFYQIFRSRAEAAALQRSRRGIGDGSVGMLQSLTVAAL
SGCVNVLLTNPIWVIVTRMQTHRKANKQQSPLDLTCVLDKALQAPAVENIPHKTIHVIQD
LYKEAGFLGFWKGVVPALIMVSNPAIQFMLYETLLKKLKKRRASNLKGADGLTALEIFLL
GAVAKLGATVVTYPLLVVKARLQVKQIIDDDKRHRYKGTFDAITKMIRYEGLSGLYKGMS
TKIVQSVFASALLFMIKEELVKGARLLVTGNTSLVKKLPSKPLR
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtcggacgcgctgatcaacggcgtcgccggcgccggcggcgggatcatcgcccagctc
ctcacctacccgctccaaaccgtgaacgcgcggcagcagacggagcgcgacccctccaag
ccggcgttcaaggacggcgccgtccgccagatgtgcctggtggtgaagcatgaagggtgg
gagcggctgtacggcggcctcatgccctcgcttgttggcactgcggcctcccagggtgtc
tactattacttctaccagatattccggagcagggcggaggccgcggctctccagcgatcc
aggagaggaatcggcgatggatccgtcgggatgctccaatccctcactgtcgctgcgctt
tctggatgtgttaatgtacttctcacaaacccaatttgggtaattgttacacgaatgcaa
actcaccggaaggcaaacaaacagcagagtcctctggatttgacgtgtgttcttgacaag
gccctacaagctcccgctgttgaaaacatacctcacaagactatccatgttattcaggac
ctttacaaagaagctggatttttgggcttctggaaaggtgtagttccagctcttattatg
gttagcaaccctgcaatccaattcatgttgtacgagactcttttgaagaagttgaaaaag
agacgtgcctctaatttgaagggagctgatggactgactgctcttgaaattttccttctt
ggtgctgttgccaaactgggtgcgactgttgttacatatcctcttctagttgtgaaggca
agacttcaggtgaagcaaataattgatgatgacaagaggcaccgctacaaaggcacattt
gatgcgatcacaaagatgatacgttatgaaggtttgtcagggctttataaaggaatgagc
acaaaaatcgtacaaagtgtttttgcttctgctctcctttttatgattaaggaggaactg
gtgaagggcgctcgattattggtaaccggcaacaccagccttgttaagaagttaccatcg
aagccattaagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347528
Entry
4347528           CDS       T01015                                 
Name
(RefSeq) peroxisomal nicotinamide adenine dinucleotide carrier
  KO
K13354  solute carrier family 25 (peroxisomal adenine nucleotide transporter), member 17
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4347528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4347528
Transporters [BR:osa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   4347528
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 4347528
NCBI-ProteinID: XP_015651222
UniProt: B7EBN1
LinkDB
Position
9:complement(19728425..19735538)
AA seq 363 aa
MSSAAVNGLAGAGGGIIAQIITYPLQTVNTRQQTERSAKKKKANGAAIANTSTLFQMLQL
FQTEGWGGLYSGLKPSLIGTAASQGIYYYFYQILKNKVEDLAVARGKKGLGDGTVGMFSW
LGIAAVAGSINVLLTNPIWVLVTRMQTHTQAEKKIMESKKELLLKDVARANSIEVSILKD
RLYKLDSEKPRPYGTIQAVREVYRESGIRGFWKGLIPTLIMVCNPSIQFMIYETLAKRLR
SKRSGKELPKKNLTAMEVFLLGAIAKLGATVVTYPLLVVKSRLQAKQEIGRNVMSRYTGT
IDAIIKMIRYEGLHGFYKGMGTKIVQSVFAASVLFMVKEELVKFVVMLIARSRTVLGPSS
KKR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtcgagtgcggcggtgaatggattggctggtgccggtggtggcatcatcgcccagatc
atcacctaccccctccagactgtgaacacccggcagcagacagagaggtcagcaaaaaag
aagaaggccaatggcgcagccatcgccaatacttccaccctcttccagatgctccagctg
ttccaaacagaaggatggggagggttgtatagcggccttaaaccctctcttattggcacc
gctgcttcacagggaatctattactacttttaccagattctcaaaaacaaggtggaagat
ctagcagttgctcgcggtaagaagggtctaggggatggtactgttgggatgttctcctgg
cttggtattgcagctgttgctgggtcaatcaatgttcttcttaccaatccaatatgggtt
ctcgtgactcgtatgcagacacatacacaagcagaaaagaagatcatggagtctaaaaag
gagcttttgctgaaggatgttgctagggccaattcaatagaggtctcaattcttaaggac
aggttgtataaacttgattctgaaaagcctcgtccatatgggacaattcaagcggtccgg
gaggtctaccgtgaatcaggcataagaggattctggaaaggacttattccaacactaatt
atggtatgtaatccatcaattcaatttatgatctatgaaacattggcaaagcgtctccgg
tcaaagagatctggaaaggaactcccaaaaaagaaccttactgctatggaggtattctta
ttaggtgcaatagcaaagctcggagctactgttgtgacatacccattgctagtggttaag
tctaggttgcaagcaaaacaagaaattggcaggaatgtgatgtccagatacacaggtacg
attgacgcgatcataaagatgatccggtatgaaggattgcacgggttttacaaaggaatg
ggtacgaagattgtacagagcgtctttgccgcctcagttctttttatggtaaaagaagag
ttggtaaaattcgtagttatgttaattgctaggagtaggactgtgctcggtcctagctct
aagaaacgatag

DBGET integrated database retrieval system