KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328860
Entry
4328860           CDS       T01015                                 
Name
(RefSeq) probable splicing factor 3A subunit 1
  KO
K12825  splicing factor 3A subunit 1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4328860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4328860
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4328860
 Complex B
    4328860
 Complex C
   U2 SnRNP specific factors
    4328860
SSDB
Motif
Pfam: PRP21_like_P Surp ubiquitin
Other DBs
NCBI-GeneID: 4328860
NCBI-ProteinID: XP_015624653
UniProt: A0A0P0VGY6
LinkDB
Position
2:8196900..8201983
AA seq 792 aa
MGAAILPLPAPDGDGDSHPQQPPPPPPGGGAKPEPPPTVATHTRPLGIIHPPPDIRVIIE
KTATFVSKNGPEFERRIISHNAGNAKFNFLQPSDPYHAYYQHRVSELAAAPPSAAASAAD
AAPEPDESGAAPPPADSAAAPTVDGEAAKADHSAPFRVPPPTKVLVPPKAELYTVHLPEG
ITGEELDIIKLTAQFVARNGKSFLTSLAQRESTNPQFHFIRPTHSMFTFFTKLTDTYSRV
LNPVEGMPALLKDLQDGAKDLTTVLERCLNRLEWDRSQEQARQQAEDEIEQERMQMQMID
WHDFVVVETIEFADDECEGLPVPLTLEELKRRKRIEDLGEEEAAMELAEPAKDVEMEMDE
EEIQLVEEGMRAARLEENEGGVQVKLAGDEEPPMRIVKNYKRPEERIPAERDPTKFVVSP
ITGELIPISEMEEHMRISLIDPKYKEQKERMLAKIKETTLAPDDEISRNIVGLARTRPDI
FGTTEEEVSNAVKAEIEKKKDEQPKQVIWDGHSGSIGRTATQALSMGGEEQVDASNVPGP
APLPRPPMPLLRPPQPLPLVNVPRFQPSAMPYPPHQQPHLMQGVPHMMPTMHPPPPPPIP
GQPQVIRMPGSMGPMPTNIPPPPPGQNPYMPGPPRPYSMPPPPHMPTMATMVNPIGIPQP
PPPLPPQPPAEEQPPQPDEPEPKRLRTDDASLIPAEQFLAQHPGPAHISVSVPNLDEGNL
RGQVLEIGVQSLSDTVGSLKEQIAGELQLPANKQKLSVRTSFLKDNLTLAYYNIGPGVVI
NLTLRERGGRKK
NT seq 2379 nt   +upstreamnt  +downstreamnt
atgggggccgccatcctgccgctcccggcgccggacggcgacggcgactcccatccgcaa
cagccgcctccccctcctcccggcggaggcgcgaagcccgagccgccgccgacggtggcc
acccacacccgccccctcgggatcatccacccgccccccgacatccgcgtcatcatcgag
aagacggccaccttcgtctccaagaacggcccggagttcgagcgccgcatcatctcccac
aacgccggcaacgccaagttcaacttcctccagccctccgacccctaccacgcctactac
cagcaccgcgtctccgagctcgctgccgctcccccctccgccgccgcctccgccgccgac
gcggcccccgagcccgacgaatccggcgccgcgccgccgccggccgactccgctgccgcg
cccaccgtcgatggcgaggcggcgaaggcggaccactccgccccattccgcgtgccgccg
cccaccaaggtgctggtgccacccaaggcggagctctacacggtgcatctgcccgagggg
atcaccggggaggagctggacatcatcaagctgaccgcgcagttcgtggcgcgcaacggg
aagagcttcctgacgagcctggcgcagcgcgagagcaccaacccgcagttccacttcatc
cgccccacgcacagcatgttcaccttcttcacgaagctcaccgacacctattcgagggtg
ctgaacccggtcgaaggcatgcctgccctactgaaggacctacaagacggggcgaaggac
ctgaccaccgtgttggagcggtgcctgaaccgcctggagtgggaccggtcgcaggagcaa
gcgaggcagcaggctgaggatgaaatcgaacaggagaggatgcagatgcagatgatcgat
tggcatgattttgttgttgtcgagacgatcgagtttgcagatgatgagtgcgagggactc
cctgtgccacttacgctggaggagttgaagcgtcggaagaggattgaggacctgggagag
gaggaggcagccatggaattggccgagccagcgaaggatgttgagatggagatggacgag
gaggagattcaacttgttgaggaaggaatgcgtgcagcaaggctcgaggaaaatgaagga
ggagttcaagttaagcttgctggtgatgaggagccgcctatgaggattgtcaagaactac
aagaggcctgaggagagaatccctgcggagagggacccaacgaaattcgttgtctcacca
ataactggggagctcattccaattagtgagatggaggagcacatgcgcatctcgcttatt
gatccaaaatataaggagcagaaagagcggatgttggcaaaaattaaggagacaacactt
gctcctgatgatgaaatctccaggaacattgtgggtcttgcccgtaccaggccagacatc
tttggaacaacagaggaagaggtctctaatgctgtcaaggcagaaattgagaagaaaaag
gatgaacagccaaagcaggttatttgggatggccattctggtagcataggtcgtactgcc
acacaggctctgtctatgggcggcgaggaacaggttgatgcttcgaatgttcctggtcca
gctccacttccccgccctcccatgccattgcttagacctcctcagccacttccactggtt
aatgttccacgctttcaacctagtgcaatgccatatcccccacaccaacaacctcatctc
atgcaaggagttccacatatgatgcctaccatgcatccgcctccaccaccgccaatacca
ggtcagccgcaggtgattaggatgccaggttcaatgggtcctatgccaaccaatatacct
ccgcctccaccaggccaaaatccctacatgcctggcccgccgcgtccatactccatgcct
ccaccgccacacatgccaaccatggcaaccatggtcaaccccattgggattcctcagcct
ccaccacctttgcctccacaaccacctgctgaggagcagccacctcaacctgatgaacca
gaacctaaaaggctgagaacagatgacgcttctcttataccagcagaacagttccttgct
cagcacccgggccctgctcacatctcagtgtctgtacccaaccttgatgaaggaaacctg
cgaggccaagtgttggagatcggtgtccaatcactctcagacacagttggcagtctaaag
gagcagattgctggagagttgcagctccctgctaataagcagaagttgagcgtgcggact
agtttcctcaaagacaatctcactcttgcttactacaacattggccctggagtggtgatc
aatttaacactgagggagcgtggtgggagaaagaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332334
Entry
4332334           CDS       T01015                                 
Name
(RefSeq) splicing factor 3A subunit 2
  KO
K12826  splicing factor 3A subunit 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4332334
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4332334
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4332334
 Complex B
    4332334
 Complex C
   U2 SnRNP specific factors
    4332334
SSDB
Motif
Pfam: SF3A2 zf-met CactinC_cactus DUF6709 TUTase
Other DBs
NCBI-GeneID: 4332334
NCBI-ProteinID: XP_015632541
UniProt: Q10NP6 A0A8J8YQE1
LinkDB
Position
3:complement(8660218..8663045)
AA seq 321 aa
MDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTL
HNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRKFAPRKSVKIGRPGYQVTKQ
YDPDMKQHSFLFEIGYPEIEENSKPRHRFMASYEQKVESWDKKYQYLLFAAEPYEIIGFK
IPSAEIDKSADKFFNYWDPDKKQYILQLYFKTRQPEANKPPAAPGTLPNGSGGPPRPPPP
QVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPPPMTGGAM
ANFTPGAPPRPPMQGFPGPQQ
NT seq 966 nt   +upstreamnt  +downstreamnt
atggatcgcgagtggggctccaagcccggcagcggcggcgccgcctccgcccagaatgag
gccatcgaccggcgggagcgcctccgccgcctcgccctcgagaccatcgacctcgccaag
gacccctacttcatgcgcaaccacctcggcagctacgagtgcaagctgtgcctgacgctg
cacaacaacgaggggaactacctggctcacacgcaggggaagcggcaccagaccaacctc
gccaagcgtgccgcccgcgaggccaaggacgcgcccgcgcagccccagcccaacaagaga
aagttcgcgccccgcaagtccgttaagattggaagacctgggtatcaggtgactaagcag
tatgatcctgacatgaagcaacactcatttctttttgagattggttatcctgaaattgaa
gaaaacagcaagccaaggcaccgtttcatggcatcatatgaacagaaagtcgaatcttgg
gataaaaagtatcaatatctactttttgcagcagagccctatgaaattattggctttaag
ataccaagcgcagagatcgacaagtcagcagataaattcttcaactattgggatccagac
aagaaacagtacattctccaactatacttcaaaacaagacaaccagaagctaataagccg
cctgcggctcctgggactttgccaaatggatctggaggtccaccacgcccacccccaccg
caggttccgccacccccgccacaggctccgccgccgcctccaccaaatgcacctatgggt
atgcccccaaggatcccacccccacctgttggtggtactcaacctccaccaccaccgccc
ccacttgcaaatggacctccacgatcaatcccacccccacctatgaccggtggtgcaatg
gctaacttcactcctggagcacctcctcgtcctccaatgcaaggatttcctgggccgcag
cagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333915
Entry
4333915           CDS       T01015                                 
Name
(RefSeq) splicing factor 3A subunit 3
  KO
K12827  splicing factor 3A subunit 3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4333915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4333915
Spliceosome [BR:osa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    4333915
 Complex B
    4333915
 Complex C
   U2 SnRNP specific factors
    4333915
SSDB
Motif
Pfam: SF3a60_Prp9_C SDE2_2C SF3A3 SF3a60_bindingd SAP Desulfoferrod_N Rnk_N
Other DBs
NCBI-GeneID: 4333915
NCBI-ProteinID: XP_015633103
UniProt: Q10DW3 A3AM39
LinkDB
Position
3:complement(29039344..29045591)
AA seq 507 aa
MASTVLEATRAKHEDMERLERLAVRELQREPANARDRLYQSHRVRHMLDLVISTSGKLVE
IYEDKDNARKDEISNHLSSTVQAEIFPKFYDRLKEIRDYHRRNPSARFVSATDDFEELLK
EEPAIEFTGEEAFGRYLDLHELYNEFINSKFGTPMEYSAYVGTFSHVEKMAQNLKTSRQY
REYLEHILEYLTSFLYHTEPLQDIEKIFAKLESEFEEQWINGEVPGWESKDPEKESAQES
VIDLDYYTTVEELVELGPEKLKEALAARGLKSGGTVQQRAERLFLLKHTPLEQLDRKHFA
KGSHSSVSNATSNGNNFKDNLKKEIALMEVKMRRLCELLDEIIVRTKENAEKKLTLTYEE
MEAEREEEEVQADSESDDEDQQIYNPLKLPMGWDGKPIPYWLYKLHGLGQEFKCEICGNH
SYWGRRAYERHFKEWRHQHGMRCLGIPNTKNFNEITSIQEAKELWEKIQQRQGLNKWRPD
LEEEYEDQEGNIYNKKTYTDLQRQGLI
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcgtcgacggtgctggaggcgacgcgggcgaagcacgaggacatggagaggctggag
cggctggcggtgcgggagctgcagcgggagcccgccaacgcgcgcgaccgcctctaccag
tcccaccgcgtgcgccacatgctcgacctcgtcatctccacctccggcaagctcgtggaa
atctacgaggacaaggataatgctaggaaggatgagatctccaaccatcttagttccaca
gtgcaagctgaaatctttccaaagttctatgacaggctcaaagagatccgtgattaccat
aggcgtaatccttctgcccgtttcgttagtgcaactgatgatttcgaagagctactaaag
gaggaaccggctattgaattcactggagaggaagcttttggccgatacctggacttgcat
gagctttacaatgagttcataaattccaagtttggaactccaatggaatactcagcatat
gttggcaccttttctcatgtggagaagatggcacaaaatctgaaaacctccaggcaatac
agagaatacctggagcatattttggagtatctgacatcatttctgtatcacacagaacca
ttgcaagacattgagaagatttttgcaaagttggaaagcgagtttgaagaacagtggatc
aatggtgaagtgcctggatgggagagcaaggacccagagaaagaatctgcacaagagtca
gtaatagaccttgattactataccactgttgaagagcttgttgagctgggcccagaaaag
ttgaaagaggctttagctgctcgtggattaaaaagtggtggtactgttcaacagcgtgct
gagcgacttttcttgttgaagcatacacccttggaacaattggatcgtaagcattttgcc
aaaggttcacacagttctgtctccaatgctacttctaatggtaacaatttcaaggataat
ttgaagaaggaaattgctttaatggaagtaaagatgaggcgcctttgtgagctactagat
gagatcattgtacggacaaaggaaaatgcagagaagaagctgactctcacatatgaagaa
atggaagcagaacgagaagaggaagaagtgcaagctgatagtgaaagtgatgatgaagac
caacaaatctacaatcctcttaagttgccgatgggttgggacggcaaacctataccctat
tggctatataagctccatggtcttggtcaggaattcaaatgtgagatatgtggaaaccac
agctactgggggcgacgggcttatgagcggcatttcaaggagtggcgccatcagcacggg
atgcgctgtcttggaattcctaatactaagaacttcaatgaaatcacatccatccaggag
gcaaaagaactctgggagaaaattcaacaacgacaagggctgaacaagtggcggccagac
ctagaagaagagtacgaagatcaggagggaaatatctacaacaagaagacctacactgat
ctgcagcgccagggcctgatttag

DBGET integrated database retrieval system