KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328861
Entry
4328861           CDS       T01015                                 
Name
(RefSeq) peroxisome biogenesis protein 7
  KO
K13341  peroxin-7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4328861
SSDB
Motif
Pfam: WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 4328861
NCBI-ProteinID: XP_015624658
UniProt: Q0E2F5 Q6EUD4
LinkDB
Position
2:complement(8204968..8206397)
AA seq 322 aa
MPAFKAPAPGFSVRFSPFHEQRLLAAASQHFGLVGNGHLLVLDLSAAAAPGGAPAPPPVF
AFPTSDALFDCAWSESHESLCAAASGDGSVRLFDVALPPAQNPVRLLREHAREVHGLDWN
PVRRDAFLSASWDDTLKLWSPDRPASVRTFRGHEYCVYAAAWSARHPDVFASASGDRTAR
VWDVREPAPTLVIPAHDHEVLSLDWDKYDPSILATGSVDKSIRVWDVRAPRAPLAQLAGH
GYAVKRVKFSPHRQGMLMSCSYDMTVCMWDYRKEDALLARYGHHTEFVAGIDMSVLVEGL
LASTGWDEMIYVWPFGSDPRAM
NT seq 969 nt   +upstreamnt  +downstreamnt
atgccggcgttcaaggcgccggcgccgggcttctccgtgcgcttcagcccgttccacgag
cagcgcctcctcgcggccgcctcccagcacttcggattagtcggcaacggccacctcctc
gtcctcgacctctccgccgccgccgccccggggggcgcgccggcgcccccgccggtgttc
gccttcccgacctccgacgcgctgttcgactgcgcgtggtcggagtcccacgagtccctc
tgcgccgccgcctccggggacgggtccgtgcgcctgttcgacgtcgcgctgccgcccgcg
cagaaccccgtccgcctcctccgggagcacgcgcgggaggtgcacggcctcgactggaac
cccgtccgccgcgacgccttcctctccgcgtcctgggacgacacgctcaagctctggtcc
ccggaccgcccggcctccgtgcgcaccttccgcggccacgagtactgcgtctacgccgcc
gcgtggtcggcgcgccacccggacgtcttcgcctccgcgtccggcgaccgcaccgcccgc
gtctgggacgtgcgcgagccggcgcccacgctggtcatcccggcgcacgaccacgaggtg
ctctcgctcgactgggacaagtacgatccgtccatcctcgccaccggctccgtcgacaag
tcgatccgcgtctgggacgtccgcgcgccgcgggcgccgctggcgcagctcgccgggcac
gggtacgccgtcaagcgcgtcaagttctcgccgcaccggcagggcatgctcatgtcctgc
tcctacgacatgacggtgtgcatgtgggattaccgcaaggaggacgcgctgctcgcgagg
tatggccaccacactgaattcgttgccgggatcgacatgagcgtgctcgtggaagggttg
ctcgcgagcaccgggtgggacgagatgatctatgtgtggccatttggctctgatcctaga
gcaatgtaa

DBGET integrated database retrieval system