KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328910
Entry
4328910           CDS       T01015                                 
Name
(RefSeq) spermine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4328910
   00330 Arginine and proline metabolism
    4328910
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4328910
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     4328910
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_24 Methyltransf_11 Methyltransf_30 DRE2_N
Other DBs
NCBI-GeneID: 4328910
NCBI-ProteinID: XP_015627369
UniProt: Q6ET01
LinkDB
Position
2:complement(8726614..8730662)
AA seq 397 aa
MEGGGARNGSTTGAARTGGSGGDAAAGGGGGSAGNGKPLPPCCVKARAAAPESEAKCHAT
VVSGWFTEPRSRGGKTSKVQYYNNPMWPGEAHSLKVEKILYQGKSPYQEVLVFESSTYGK
VLVLDGIVQLTDKDECAYQEMITHLPLCSIPSPKKVLVIGGGDGGVLREICRHGSVESID
ICEIDQLVIDVCKDFFPDLSVGFKDPRVRLHVGDAVEFLRNAPEGTYDAIIVDSSDPIGP
AQELVEKPFFDTIARALRPGGVLCNQAESMWLHTHLIQDMLSICRETFKGSVHYAWTSVP
TYPSGVIGFLLCAKEGPPVNFLTPANPIEKLEGAMEAGRDIRFYNSEMHRAAFVLPTFAR
RELEAYCTTVEREQQEETTAEPLKMNIMPNSEILTAS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggagggtggaggcgcaagaaatggctcgacgaccggggcggcgcggacaggggggagt
gggggtgatgctgctgctggtggtggtggtggctccgccgggaacgggaagccgctgccc
ccttgctgcgtcaaggccagggcggcggcgcctgaatccgaggccaagtgccacgccacc
gtggtgtccggatggttcaccgagccccgctcgcgcggcggtaaaacgagcaaagtgcag
tattacaataacccgatgtggccaggagaggcccattcactgaaagttgagaagatcttg
tatcaggggaagtcaccataccaagaagttttagtttttgagtcctcaacctatggaaaa
gttcttgtccttgatggtattgtccagttgactgataaggatgaatgtgcgtaccaggaa
atgattactcaccttccgctttgctcaattccatccccaaagaaagttttggttattgga
ggtggtgatggtggagtccttcgggagatatgtagacatggttctgtggagtcaattgat
atatgtgaaattgatcagctagttattgatgtttgtaaagatttcttcccagatttatct
gttggattcaaagatcctcgtgttcggcttcatgttggtgatgctgtggagttcttaagg
aatgctcctgaagggacatatgatgctattattgtcgattcatcagacccgattgggcct
gcccaggaacttgtggagaagccattttttgacacaatcgcaagagctttgaggcctggt
ggtgttctttgtaatcaggctgagagcatgtggttgcatacgcatcttatccaggacatg
ctttcgatctgccgtgagacattcaagggttctgtccactatgcctggacgagtgtcccg
acatatcccagtggtgtgattgggtttctgctatgtgccaaagaaggtccaccagtcaac
ttcctgactcctgcaaatccaattgaaaaactagaaggagctatggaagcaggaagggat
attagattttataattcagagatgcatagagccgcatttgttctcccaacctttgcaagg
agagagctagaggcgtattgtactaccgttgaaagggaacaacaagaagaaacaacggcc
gagcctctgaagatgaacattatgccgaacagtgaaattcttactgcttcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341195
Entry
4341195           CDS       T01015                                 
Name
(RefSeq) spermine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4341195
   00330 Arginine and proline metabolism
    4341195
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4341195
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     4341195
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 Methyltransf_30 Methyltransf_4 Methyltransf_24 DRE2_N Methyltransf_23 Methyltransf_12 DUF5541
Other DBs
NCBI-GeneID: 4341195
NCBI-ProteinID: XP_015644434
UniProt: Q7XAP2 B9FTK5
LinkDB
Position
6:19614249..19619661
AA seq 387 aa
MEGGGAKDGSAAAAQTRGSGDDGSHKPLPPCCLKAKAAAAESEAKCHATVVSGWFTEPRS
HSGKTSKVQYFNNPMWPGEAHSLKVENILYQGKSPYQEILVFESSTYGNVLVLDGIVQLT
EKDECAYQEMVTHLPLCSIPSPKSVLVVGGGDGGVLREIARHASVENIDICEIDQLVIDV
CKDFFPQLSVGFKDPRVQLHVGDAVDFLRNAPEGKYDAIIVDSSDPIGPAQELVEKPFFQ
TIARALKPGGVLCNQAESMWLHTHLIQDMLSICRETFKGAVHYAWTSVPTYPSGVIGFLL
CAKEGPAVNFLSPVNPIEKLEGAMEAGREIRFYNSEVHRAAFVLPTFVRRELESHNTCAE
KDKSETKPVAKPKKMKIMPNSAIPTAS
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggagggtggaggcgcaaaagatggttctgcagcggcagcgcaaacaagggggagtggg
gatgatggttcccacaagccgctgccgccttgctgtctcaaggcgaaggctgcggcagca
gagtctgaggcaaaatgccatgccacagtggtgtcagggtggttcacggaaccccgctcg
cactctggtaaaacaagcaaagtgcagtacttcaacaatccaatgtggcctggagaagct
cattctctgaaagtagagaatattctgtatcaagggaaatcaccataccaagaaatctta
gtttttgagtcctcaacctatgggaatgttctggtgcttgatggtattgtgcagctgacc
gaaaaggatgaatgtgcataccaggaaatggttactcaccttccactgtgctcgattcca
tcccccaaaagtgttttggttgtcggaggtggtgatggtggtgtgctacgagaaatagcc
agacatgcctcagtggagaacatcgatatatgtgaaatagaccagctagttattgatgtc
tgtaaagatttcttcccacaactatctgttggattcaaagatccccgtgttcaacttcat
gttggtgacgctgtggatttcttgagaaatgcccctgaagggaaatatgatgctatcatt
gttgattcatctgacccaattgggccagctcaggagcttgtggagaagcccttttttcag
acaattgctagagctctaaagcctggtggagttctatgcaatcaagctgagagtatgtgg
ctgcacacacatctaattcaagatatgctttctatctgtcgtgaaacattcaagggagct
gtgcattatgcctggacaagcgttcctacctatcctagtggtgtcattggttttttgcta
tgtgcgaaagaaggtccagcagtgaacttcctttctcctgtgaatccaattgagaaactg
gaaggagctatggaagctggaagggaaatcagattttacaattcagaggttcatcgggct
gcttttgttctgccaacatttgtaaggagagaactggaatcacacaatacttgtgctgaa
aaggataaatcagaaaccaagccagtcgcgaaaccaaagaagatgaaaataatgccgaat
agtgccattccgactgcttcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342996
Entry
4342996           CDS       T01015                                 
Name
(RefSeq) spermidine synthase 1
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00330  Arginine and proline metabolism
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Module
osa_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4342996
   00330 Arginine and proline metabolism
    4342996
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4342996
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     4342996
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_30 Kelch_1 MTS DRE2_N Methyltransf_11
Other DBs
NCBI-GeneID: 4342996
NCBI-ProteinID: XP_015644580
UniProt: Q9SMB1
LinkDB
Position
7:complement(12716627..12722907)
AA seq 323 aa
MEAEAAAKRARESGDAAAAGAGEQAGISAVIPGWFSEISPMWPGEAHSLKVEKVLFQGKS
DYQNVMVFQSSTYGKVLVLDGVIQVTERDECAYQEMITHLPLCSIKDPKKVLVIGGGDGG
VLREVSRHSSVEQIDICEIDKMVVDVSKQFFPHLAVGFEDPRVSLHIGDGVAFLKNAPEG
TYDAVIVDSSDPIGPAQELFEKPFFQSVARALRPGGVVCTQAESIWLHMHIIEDIVANCR
QVFKGSVNYAWTTVPTYPSGVIGFMLCSTEGPTVDFQHPIFNIEDNEFSTKSKGPLKFYN
SEIHSASFCLPSFAKRVIGSKAN
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaggccgaggcggcggcgaagagggcgcgggagagcggtgacgcggcggcggccggt
gccggcgagcaggcgggtatctctgccgtcatccctggatggttctccgagattagcccc
atgtggcctggtgaggcacactcattgaaggtcgaaaaggtactattccaaggaaagtcg
gactaccaaaatgtgatggtgtttcagtcctccacgtacggcaaggtgcttgtgctggat
ggagtgattcaggtcactgagagggatgagtgtgcttaccaagagatgattacccacctc
cccctttgctctatcaaagatcccaagaaggtgttagttattggaggtggagatggtggt
gttttgcgtgaagtttcacgacattcctcggtggagcaaattgacatatgtgaaattgat
aagatggtggtagatgtctccaaacaattttttcctcatctggctgttggatttgaagac
ccccgtgtgtcattacacattggagatggcgtggcctttttgaaaaatgctccagagggt
acttatgatgcagttattgtggattcctctgatccaataggaccggctcaagagcttttc
gagaagcctttcttccagtcagttgccagagctttgcgtcctggtggtgttgtatgtacc
caggcagagagcatatggttgcatatgcatattattgaagatattgtagctaattgtcgc
caagtttttaaaggctcagtgaattatgcttggacaacagtaccaacataccctagtggt
gttattggttttatgctttgctccaccgaggggcctactgttgatttccagcatcctatt
tttaacattgaggataatgagttctcaacaaaatcgaaaggaccacttaagttctacaat
tccgagatccactcagcatcattttgtttgccgtcttttgcgaagagagtcattggatcc
aaggccaactag

DBGET integrated database retrieval system