KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328912
Entry
4328912           CDS       T01015                                 
Name
(RefSeq) cyclic nucleotide-gated ion channel 1
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4328912
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4328912
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4328912
SSDB
Motif
Pfam: Ion_trans cNMP_binding Cation_ATPase_C
Other DBs
NCBI-GeneID: 4328912
NCBI-ProteinID: XP_015625480
UniProt: B9F4U7
LinkDB
Position
2:complement(8747059..8756034)
AA seq 700 aa
MAFREDKYVRFHDWRSEHSVGSEKTVLEGRHNVFDSLMDRTVGAFSFLGNSSHPETLNKP
ASEEKKSKTRVLDPQGPFLQRWNKIFVISCLIAVSVDPLFFYIPVIDGDNICLYLDKKLE
IIASVLRFFTDIFYLLHIIFQFRTGFIAPSSRVFGRGVLVEDTFAIAKRYLSTYFLIDFL
AVLPLPQVLVLVVLPRLQGSSVMTAKNILMVIVICQYVPRLIRIIPLYLQITRSAGIITE
TAWAGAAFNLLIYMLASHVLGALWYLLSIQREDTCWKDACSRHDGCDSGSLFCGSNAARN
NSFLQDFCPTNGTDNADPTFGIYLPALQNVSQSTSFFEKLFYCFWWGLQNLSSLGQNLKT
STYTWENLFAVFVSTSGLVLFALLIGNVQTYLQSASVRIEEMRVKRRDTEQWMAHRLLPD
NLKERILRHEQYRWQETRGVDEEGLLSNLPKNLRREIKRHLCLSLLMRVPMFENMDEKLL
DAMCDRLKPMLYTEGSCIIREGDPVNEMLFIMRGNLESMTTNGGQTGFFNSNIIKGGDFC
GEELLTWALDPTSASNLPSSTRTVKTLSEVEAFALRADDLKFVATQFRRLHSKQLQHTFR
FYSQQWRTWAACFIQAAWHRYCRKKLEDTLFEKEKRLQAAIVSDGSSSLSLGAALYASRF
AGNMMRILRRNATRKARLQERVPARLLQKPAEPNFFAEDQ
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggctttccgagaggacaaatatgtgagatttcatgactggagatcagaacattctgtt
ggttccgaaaagacagttttagaaggaaggcataatgtgtttgactcgctaatggataga
actgtaggagccttttcattcctagggaattcctcacatcctgaaaccctcaacaaacca
gcttctgaggaaaagaagtccaaaacaagagttcttgatcctcaagggccattcttgcag
agatggaacaagatatttgttatatcatgccttattgcagtttctgtggacccgttattc
ttctatattccagtgattgatggtgacaatatctgcttatatctggacaaaaagttggaa
atcatagcaagtgtcctgcgattttttacagatatattctatttactccatataattttt
cagttcaggacaggctttattgctccttcctctagagtgtttggtcgaggtgtcttggtt
gaggacacctttgcaatagcaaagcggtatctatcaacatattttctgattgatttctta
gctgttctgccccttcctcaggtgctcgtattggtagttctaccccgtctgcaaggctcc
tcagttatgacggcaaaaaatatattaatggttatagttatttgtcaatatgtacctcgg
ttgattcgaataataccattgtaccttcaaatcaccagatcggctggtataattacagag
acagcatgggctggtgctgcatttaaccttttaatttatatgcttgctagtcatgtcctt
ggagctctttggtaccttctttccattcaacgagaagacacctgttggaaagatgcatgt
agtagacatgatggctgtgattcgggatctttattttgtgggagtaatgcagctagaaat
aacagtttcttacaagatttttgcccgacaaatggaactgacaatgcagatccaactttc
ggaatttatcttccagctcttcaaaatgtttcacaatcaacgagtttctttgaaaaattg
ttttattgcttttggtggggtctgcaaaatctaagttctcttggtcaaaatcttaagaca
agcacgtatacatgggagaatctatttgctgttttcgtctcgacatcaggtctagttttg
tttgcactccttattggtaatgtgcagacctatctacaatctgcctctgtgcgtatagaa
gaaatgagagtgaaacggcgtgacacagagcaatggatggcacatcgattacttcctgat
aacctcaaggagcgaatactgcgtcatgaacaatataggtggcaagaaacaagaggggtt
gatgaagagggccttctttcaaatcttcctaagaatcttaggagagagataaagaggcat
ctttgcctgtcgcttctcatgagggttccaatgtttgaaaacatggatgagaagctcttg
gatgccatgtgtgatcgtctaaagcccatgctgtacacagaaggcagctgcatcattcgc
gaaggagacccagtgaatgaaatgctcttcatcatgagaggaaatcttgagagtatgacg
acaaatggtggacagactggctttttcaactccaatattatcaaaggtggagatttttgt
ggtgaagagcttctcacatgggcacttgaccctacttcagcttcaaaccttcccagctca
accaggactgtgaaaacgctgtctgaagtcgaagcttttgctttgagggctgatgacttg
aagtttgtagccacccaattcaggagactccacagcaaacaactccagcatacatttaga
ttctattcacagcaatggagaacctgggcagcttgttttatacaggcagcttggcataga
tactgcagaaagaaactggaggatactttgtttgagaaggagaagaggttgcaagcggca
attgtcagtgatggttcgagttcgctcagtcttggtgcggcgctatatgcttcacgtttt
gctggtaatatgatgcggatcttacggagaaatgccactcgaaaggcccgtttgcaggaa
agagtgcctgcaaggttattacagaagcctgcagaaccgaactttttcgctgaagatcag
taa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330041
Entry
4330041           CDS       T01015                                 
Name
(RefSeq) putative cyclic nucleotide-gated ion channel 15
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4330041
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4330041
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4330041
SSDB
Motif
Pfam: Ion_trans cNMP_binding
Other DBs
NCBI-GeneID: 4330041
NCBI-ProteinID: XP_015623986
LinkDB
Position
2:25052057..25055268
AA seq 702 aa
MVLTRSCRGSSTMACNGSRAVRFQNDMELPHWKTSSVPECTSSSRSTKHGKAQHQQQQHH
DPRKWRRGGGGGGSLKDRVLSRAFSEELESLMSSGANHLFFDPRGQLIHLWSKIFLAACL
ASLFVDPLFLYLTGTRQNMCIELKYSLAFTLSMIRSLLDLFYAAHIFFRFRTAFIAPSSR
VFGRGELVIQPCKIARRYLAGTFWFDLVTALPLPQFVIWIVIPKLKESATANRKNILRFS
IIFQYLPRLFQIFPLSRQIVMATGVMTETAWAGAAYNLILYMLASHVLGALWYLFSVQRQ
EACWREACHVEGPSCQTLFFDCKTVSSNRTMWYELSNITSLCTPSNGFYQFGIYGEALDN
GLTSSSFTQKYFYCFWWGLKNLSCLGQNLSTSLFIGEITFATVIGVLGLVLFALLIGNMQ
SYLQATMVRLEEWRTKRTDMERWMNHRQIPQPLKQCVRRYHQYKWLATRGVDEEALLEDL
PMDIRRDIKRHLCLDLVRRVPLFDEMDERMLEAICERLRPALYTRGTRLVRELDPVDSML
FIIRGYLDSYTTQGGRSGFFNSCRIGAGEFCGEELLPWALDPRPAASLPLSTRTVRAVSE
VEAFALVADDLRFVASQFRRLHSARIRHRFRFYSHQWRTWAACFIQAAWRRNKRRRASME
LRMREGGEARPGGSVRCRRHSCDGKALIKKPMEPDFTVEEED
NT seq 2109 nt   +upstreamnt  +downstreamnt
atggttttgaccagaagctgccggggatctagcaccatggcatgcaatggctcacgagcc
gtcaggtttcagaatgacatggagctcccgcactggaaaacatcaagcgtgccggagtgc
acgtcgtcgagcaggtcgacgaagcacggcaaggctcaacaccagcagcagcagcaccac
gacccgaggaaatggcggcgaggcggcggcggcggcggcagcctcaaggaccgggtgctg
tcgcgggccttctcggaggagctggagtcgctgatgagctccggggcgaaccacctcttc
ttcgacccgcgcgggcagttgatccacctgtggagcaagatcttcctcgccgcctgcctc
gcctccctcttcgtcgacccgctcttcctctacctcacggggacgaggcagaacatgtgc
atcgagctgaagtactcgctggcgttcacgctctccatgatccgctccctgctcgacctc
ttctacgccgcgcacatcttcttccgcttccgcaccgccttcatcgccccctcgtcgcgc
gtgttcggcaggggcgagctcgtcatccagccctgcaagatcgccaggaggtacctcgcc
ggcaccttctggttcgatctcgtcaccgcgctgcccctaccgcagttcgtgatatggatt
gtgataccgaagctgaaagagtccgcgacggccaaccggaagaacatcctccgcttcagc
atcatcttccagtacctgccgcggctgttccagatcttcccgctctcgaggcagatcgtc
atggccaccggcgtcatgacggagaccgcgtgggccggcgccgcctacaacctcatactc
tacatgctcgcgagccacgtgctgggagcactgtggtacctcttctcggtgcagaggcag
gaggcgtgctggcgagaggcgtgccacgtggagggcccgtcgtgccagaccctgtttttc
gactgcaagacggtcagcagcaacaggacgatgtggtacgagctgagcaacattacgagc
ttgtgcacgcccagcaatggcttctaccagttcggcatctacggcgaggcgctggacaac
gggctgacgtcgtcgtccttcacgcagaagtacttctactgcttctggtgggggctgaag
aacctgagctgcttggggcagaatctgtcgacgagcctgttcatcggggaaataacattc
gcaaccgtcattggcgttcttgggctggtgctgtttgctctgctcatcggcaatatgcaa
tcttacttgcaggcgacgatggtgcggctggaggagtggcggacgaagcggacggacatg
gagcgatggatgaaccaccggcagataccgcagccgctgaagcagtgcgtgaggaggtac
caccagtacaagtggttggccacccgcggcgtcgacgaggaggcgttgctcgaggacctc
cccatggacatccgccgcgacatcaagcgccacctctgcctcgacctcgtccggagagtg
ccgctgttcgacgagatggacgagcggatgctggaggcgatctgcgagcggctgcggccg
gcgctgtacacgaggggcacgcggctggtgcgggagctggacccggtggactccatgctg
ttcatcatccgggggtacctcgactcgtacacgacgcaggggggcaggtcggggttcttc
aactcgtgccgcatcggggcgggggagttctgcggggaggagctcctgccgtgggcgctg
gacccgcgccccgccgcgtcgctgccgctgtccacgcgcaccgtgcgggccgtgtcggag
gtggaggcgttcgcgctcgtcgccgacgacctccggttcgtggcgtcgcagttccggcgc
ctgcacagcgcgcgcatccggcacaggttccgcttctactcccaccagtggcgcacgtgg
gcggcgtgcttcatccaggccgcctggcgccggaacaagcggcgccgcgcgtccatggag
ctcaggatgcgggagggcggcgaggcgcggccgggagggagcgtgaggtgtcgtcggcac
agctgcgacggcaaagcgctcatcaagaaacccatggaaccggatttcaccgtcgaagaa
gaggactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330882
Entry
4330882           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 20, chloroplastic
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4330882
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4330882
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4330882
SSDB
Motif
Pfam: Ion_trans cNMP_binding DUF6525 Ion_trans_2
Other DBs
NCBI-GeneID: 4330882
NCBI-ProteinID: XP_015626187
UniProt: Q0DX56 Q6ZHE3
LinkDB
Position
2:32648593..32659777
AA seq 772 aa
MSDQERDDIPMLLRNVELPTFPPRSTSMCIPVRDDEYEEDTFVPHTGPLFVQPPTQTAAA
GIPFTNTPDMPPRPPQGKQVNKPHAIMPEEIGGNRWSYSGNVPKNEHLMMSGPLGQCDDP
DCVNCPPACKNKRHFHRGSSTLDSKFHNFLCEHGGGWKKEIERFLSRIPVMNPHAKVVQQ
WNQFFVISCLVAIFIDPLFFFLLSVQKDNKCIVLNWHFATALAVVRSVTDAIYFLHMLLQ
FRLAYVAPESRVVGAGDLVDEPKKIAVRYLRGYFLLDFFVVLPLPQVMILLVIPKYVGLS
TANYAKNLLRITVLLQYVPRIIRFVPLLGGQSDSSANGFIFESAWANFVINLLMFVLAGH
VVGSCWYLFGLQRVNQCLRNACSASKIPSCDGFIDCGRGINIGKQNQLSRQQWFNDSAST
ACFDTGDNGFHYGIYEQAVLLTTEDNAVKRYIYSLFWGFQQISTLAGNLVPSYFAWEVLF
TMAIIGLGLLLFALLIGNMQNFLQALGRRRLEMQLRRRDVEQWMSHRRLPEDLRRRVRRA
ERFTWAATQGVNEEELLSNLPEDIQRDIRRHFFRFLNKVRLFTLMDWPILDAICDKLRQN
LYISGSDILYQGGPVEKMVFIVRGKLESISADGSKAPLHEGDVCGEELLTWYLEHSSANR
DGGRMRFHGMRLVAIRTVRCLTNVEAFVLRASDLEEVTSQFSRFLRNPRVQGAIRYESPY
WRTIAATRIQVAWRYRNRRLKRAGMSKLNDQSYNSALERGARECDARQHGRV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtctgaccaggagagagatgatattcctatgctactaagaaatgttgagctaccaacg
tttcctcctagaagtacatcaatgtgcataccagttagggatgatgaatacgaagaagac
acatttgtaccccatactggtcctctgtttgttcagccaccaacacaaactgcagcagcg
ggcattccatttacaaatacaccagatatgcctcctcgacctccacaaggaaaacaagtc
aacaagccacatgcgataatgccagaagaaattggaggaaacaggtggtcttatagtggg
aatgttccaaagaatgaacatttgatgatgtctggacctttgggacaatgtgacgatcct
gattgtgtcaactgccctcctgcttgtaaaaacaaaaggcattttcacagaggatcaagt
acattggacagtaagttccataattttctttgtgagcatggtggtggatggaagaaggaa
attgagcgtttcctttcacgcattccagttatgaacccacatgcaaaagttgttcagcaa
tggaatcagttctttgtgatatcatgcctggttgccatattcattgacccactatttttc
ttcctattatcagttcaaaaggataacaagtgcattgtgttgaactggcattttgctaca
gcacttgcagttgtgagaagcgtgactgatgctatttattttctacacatgcttcttcag
ttcagactggcttatgtagctccagaatcgcgagtagtgggagctggagatttagtagac
gagccaaagaaaattgctgtccgttatcttcgtggatattttttactcgacttcttcgtt
gtgcttccactccctcaggtgatgatattgctggtcatccctaaatatgttgggttatca
actgcaaactatgctaagaatttactgcgtatcactgttcttcttcagtatgttccccgc
atcatcagatttgtaccattgcttggtggtcagtctgactcatctgccaatggattcata
ttcgagtcagcgtgggctaactttgtgattaaccttctaatgtttgttttggcgggacat
gttgttggttcatgttggtacctatttggattgcagagggtcaaccaatgcctacggaat
gcttgttctgcatcaaaaattccatcttgtgatggttttatagattgtggacgtggcatt
aatattgggaagcagaatcaactaagcagacagcagtggtttaatgattcagcctcaaca
gcttgtttcgacactggagacaacggtttccactatgggatttatgaacaggctgttttg
ctaactacagaggacaatgctgttaaacgttatatatattcattattttggggtttccag
caaataagtacgctagctggtaatcttgtcccaagttattttgcatgggaagtcctgttt
actatggctattattggtttggggctgttgcttttcgcattacttattgggaacatgcaa
aattttctccaagctcttggaagacggagactagaaatgcaacttaggaggcgtgatgtt
gaacagtggatgagccatagacgcctgccagaagatttaagaaggagggttagacgcgca
gaaaggttcacctgggcagctacccaaggggtgaatgaagaggagcttttaagtaattta
ccagaagatattcaaagggacatacgccgtcatttctttagatttcttaacaaggtccga
ttattcacattgatggattggcctatcttggacgctatatgtgacaaactaagacaaaac
ttgtatattagcggaagtgacatcctttatcaaggtggtccagttgaaaaaatggtcttc
atagtgaggggaaagctagaaagcatcagtgcagatggaagcaaagctccgttacatgaa
ggtgatgtatgtggagaggagctcctgacatggtacttggaacactcttcagctaacaga
gatggtgggagaatgagattccatggtatgcgtttggttgctattcgtactgtaagatgt
ttaacaaatgttgaagcttttgtactaagggcaagcgatctcgaagaagtaacttcacaa
ttttcacgattcttgcgcaatccacgagtgcagggtgcaatcaggtatgagtcaccctac
tggagaaccattgctgcaacgcgtattcaagtcgcatggaggtatcggaataggcgattg
aagcgagctgggatgtcgaagttgaacgatcaatcttataattctgcattggaacgtggc
gcgcgtgaatgtgatgctcgtcagcatgggcgggtatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330967
Entry
4330967           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 17
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4330967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4330967
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4330967
SSDB
Motif
Pfam: Ion_trans cNMP_binding UBM
Other DBs
NCBI-GeneID: 4330967
NCBI-ProteinID: XP_015627288
UniProt: A0A8J8YFQ9 B9F3N3
LinkDB
Position
2:complement(33530596..33536121)
AA seq 692 aa
MFGAGKVDDEMALKRQRTVRFYDEKAKPTIPTHQKQAGFAASKLGVASSGKNKIFVPGEE
LWYKRILDPSSDFILTWNHIFLFSCFVALFIDPLYFYVPKISYGTPNSCIGTDRHLAITV
TFFRSISDLLYFTHIIIKFRTAYINPSSTMRVFGRGDLITDPKEIAWQYLRSDFVVDAVA
ALPLPQILIWFVIPAIKYSTDEHNNNILVLIVLAQYFPRLYLIFPLTYEIVKTTGVVAKT
AWQGAAYNMLLYMIASHVLGALWYLLSVDRQTACWKSNCKNETGCDIKFLDCDVIPNQNW
ASKTAIFNTCDATNTSISFDYGMFQPALFNQAPGQRFLMKYFYSLWWGLQNLSCYGQTIT
VSTYIGETLYCIFLAVLGLVLFAHLIGNVQTYLQSITVRVEEWRLKQRDTEEWMRHRQLP
HELRERVRRFIQYKWLATRGVNEESILQALPADLRRDIKRHLCLGLVRRVPFFSQMDNQL
LDAICERLVSSLCTQGTYIVREGDPVTEMLFIIRGKLESSTTNGGRTGFFNSTTLKSGDF
CGEELLGWALVPKPTVNLPSSTRTVKALIEVEAFALQAEDLKFVANQFRRLHSKRLQHTF
RYYSHHWRTWASCFIQAAWRRYKRRKMARDLSMRESFCSMRSDDSNGEDDSPPKQNLAMK
IMSGSRKGPQNMKELPKLRKPDEPDFSAEPCE
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgtttggggcggggaaggtggacgatgagatggcgctcaagaggcagagaaccgtgagg
ttctatgatgagaaggcaaaaccaactataccaactcaccagaaacaggcagggttcgct
gctagtaaacttggtgtggcaagctcaggaaagaacaaaatttttgtgccaggagaagag
ctgtggtacaaaaggattttggacccatcaagtgacttcatcttgacatggaaccacatt
ttccttttttcgtgcttcgttgctctatttatagaccctctgtacttctacgtgccaaaa
atctcctatggcaccccaaattcgtgtattgggacagacaggcatttagccatcactgtt
acattcttccgatcaatctctgatttactatatttcactcacattataataaagtttaga
acggcatatattaatccgagctcaaccatgagggtatttggaagaggagaccttatcacg
gatccaaaggaaattgcgtggcaatatttgagatctgacttcgtagtcgatgcagtggct
gcattgcctttaccacagatcttaatctggtttgtgataccagctattaagtattccact
gatgagcataacaacaatattctggtgctgatagttcttgctcagtattttccaagacta
tacctcatattccccttgacttatgaaattgtcaaaactactggagttgtcgcaaagact
gcttggcaaggggctgcatacaatatgttgctttacatgatagccagtcatgtactaggt
gctctatggtatttgctatctgtcgatcgccaaactgcctgctggaagagcaattgcaag
aatgaaactggctgtgatattaaatttctagattgtgatgtgataccaaatcaaaactgg
gcaagcaaaactgctatcttcaatacctgtgacgcaactaacacttcaatcagttttgat
tatggcatgtttcagcctgcattgtttaatcaagccccagggcaacgtttcttgatgaag
tatttctattccctttggtggggtttgcagaatctgagttgctatggccagactattact
gtgagtacctatattggtgagactctatactgtatattcttggcagtacttggtctcgtc
ttgtttgcacatttgattggaaatgtacagacctacttgcaatctatcactgtgagggtt
gaggaatggagattaaaacaaagagatacagaggagtggatgaggcatcgtcaactccca
catgaactacgagaaagggtgagacggtttatccagtacaagtggctcgcaactcgagga
gtgaatgaagaatcaatattacaggctcttcctgcagatcttcgtcgtgacattaaacgt
cacctttgcttgggtcttgttcgccgggttcctttcttctcccagatggacaatcaactt
ttggacgccatctgtgagcgtcttgtatcatcgttgtgcacacagggcacatacattgtc
cgtgagggtgatccagtgaccgagatgctcttcatcattcgtgggaaactcgaaagctct
acaacaaatggtggccgcactggcttcttcaattcaactaccctgaaatccggtgatttc
tgcggcgaggaactgcttgggtgggctcttgtccccaaacctactgttaatttgccgtca
tccactcggacagtgaaggcactcatagaagttgaggcattcgcactccaagctgaggat
ctcaagtttgttgcaaaccaattcaggcgtctgcacagcaaaagattgcaacacactttc
cggtactactcgcaccactggagaacttgggcctcatgcttcatccaagctgcttggcgg
cgatacaagaggaggaagatggcaagggacctgagcatgagggagtcattctgctccatg
agatcagatgactcaaatggtgaagatgactcgccacctaagcagaatctcgctatgaag
atcatgagtgggagtaggaaaggacctcagaacatgaaagagttgcctaagctaagaaag
ccggatgagccagatttttcagctgaaccctgtgagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333569
Entry
4333569           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 6
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4333569
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4333569
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4333569
SSDB
Motif
Pfam: Ion_trans cNMP_binding Ion_trans_2 IQ
Other DBs
NCBI-GeneID: 4333569
NCBI-ProteinID: XP_015631537
UniProt: A0A8J8YPJ4 Q10G24
LinkDB
Position
3:25003659..25007833
AA seq 711 aa
MSYASGGGGGGELATKRSAFHIDYGGGVSLRRLAQPEALARGMITQGSAQLRTLGRSLRT
GAAMAVVFQEDLKNTSRKIFDPQDRLLVRLNRSFVVSCIVSIAVDPVFFYAPQVTANGGN
LCVGISRDLAISASVVRTVVDLFFAARIVLQFRTAYIAPSSRVFGRGELVIDTAQIAARY
FRRFFAADLLSVLPLPQIVIWKFLHRSKGAAVLSTKDALLIIVFLQYIPRVVRIYPLSSE
LKRTSGAFAESAYAGAAYYLLWYMLASHIVGASWYLLSIERVSDCWKKACNEFPGCNKIY
MYCGNDHQKGFLEWRTITRQYINETCEPRDGVMPFNYGIYTPAVRSDVIKSNDFTSKLLY
CLWWGLANLSTLGQGLQTSIYTGEALFSIFLATFGLILMAMLIGNIQTYLQSMTVRLEEM
RVKRRDSEQWMHHRLLPQELRERVRRYDAYKWVNTRGVDEEVLVANLPKDLRRDIKRHLC
LGLVRRVPLFANMDERLLDAICERLRPALYTERTFIIREGDPVDQMLFIIRGCLESITTD
GGRSGFFNRSLLEESDFCGEELLTWALDPKAGLSLPSSTRTVRALSEVEAFALHSDELKF
VAGQFRRMHSKQVQHTFRFYSQQWRTWAATYIQAAWRRHLKRRAAELRRREEEEEEAAAI
RSSTGLKTTMLVSRFAANAMRGVHRQRSRRADEVLMMPMPKPSEPDFGADY
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgtcgtacgcgtccggtggcggcggcggcggggagctggcgacgaagcggtcggcgttc
cacatcgactatgggggtggcgtgtcactgcggcggctggcgcagccggaggccctggcg
cgcgggatgatcacgcaggggtcggcgcagctgcggacgctggggcggtcgctgcggacg
ggggcggccatggcggtggtgttccaggaggacctgaagaacacctcccgcaagatcttc
gacccgcaggaccggctgctggtgcgcctgaaccgcagcttcgtggtctcctgcatcgtc
tccatcgccgtcgacccggtgttcttctacgcgccccaggtgacggcgaacggcggcaac
ctgtgcgtggggatcagccgcgacctggccatctccgccagcgtcgtgcgcaccgtcgtg
gacctcttcttcgcggcgcggatcgtgctccagttccggaccgcttacatcgctccgtcg
tcccgcgtattcggccgcggcgagctcgtcatcgacaccgcccagatcgccgcccggtac
ttccggcggttcttcgccgccgacctcctctccgtgctcccgctcccgcagatcgtgatc
tggaagttcctccaccggtccaagggcgccgccgtgctgtccaccaaggacgcgctcctc
atcatcgtcttcctccagtacatcccccgcgtcgtccgcatctaccctctctcctccgag
ctcaagcgcaccagcggcgccttcgccgagtccgcctacgccggcgccgcctactacctc
ctctggtacatgctcgccagccacatcgtgggggcatcgtggtacttgctgtcgatcgag
agggtgagcgattgctggaagaaggcgtgcaacgagttcccgggatgcaacaagatctac
atgtactgcggcaacgaccaccaaaaagggttcctcgagtggcgaaccatcacgcggcag
tacatcaacgagacgtgcgagcctagggacggcgtcatgcccttcaactacggcatctac
acgccggccgtcaggtccgacgtcatcaagtccaacgacttcacctccaagctcctctac
tgcctctggtggggccttgccaacctcagcacgctggggcaagggctgcagacgagcata
tacacgggggaggcgctgttctcgatattcctggcgacgttcgggctgatcctgatggcg
atgctgatcggcaacatccagacgtacctgcagtcgatgacggtgaggctggaggagatg
cgggtgaagcggcgcgactcggagcagtggatgcaccaccgcctcctcccccaggagctc
cgggagcgcgtccgccgctacgacgcctacaagtgggtcaacacccggggcgtcgacgag
gaggtcctcgtcgccaacctccccaaggacctccgccgcgacatcaagcgccacctctgc
ctcggcctcgtccgccgcgtcccgctcttcgccaacatggacgagcgcctcctcgacgcc
atctgcgagcgcctccgccccgccctctacaccgagcgcaccttcatcatccgcgagggc
gaccccgtcgaccagatgctcttcatcatccgcggctgcctcgagagcatcaccaccgac
ggcggccgctccggcttcttcaaccgcagcctcctcgaggagagcgacttctgcggcgag
gagctcctcacctgggcgctcgaccccaaggccggcctctccctcccctcctccacccgc
accgtcagggccctctccgaggtcgaggccttcgccctccactccgacgagctcaagttc
gtggcggggcagttccgccggatgcacagcaagcaggtgcagcacaccttccggttctac
tcccagcagtggcggacgtgggcggccacctacatccaggccgcctggaggcgccacctc
aagcggagggcggcggagctgcggcggagggaggaggaggaggaggaggccgccgcgatc
cgctcgtcgacggggctcaagaccaccatgctggtgtcgcgcttcgccgccaacgccatg
cgcggcgtccaccggcagcgatccaggcgggccgacgaggtcctcatgatgcccatgccc
aagccctccgagcctgatttcggcgccgattactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334172
Entry
4334172           CDS       T01015                                 
Name
(RefSeq) cyclic nucleotide-gated ion channel 2
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4334172
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4334172
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4334172
SSDB
Motif
Pfam: Ion_trans cNMP_binding IQ TMEM_230_134
Other DBs
NCBI-GeneID: 4334172
NCBI-ProteinID: XP_015633172
UniProt: B9F5T0
LinkDB
Position
3:31344597..31350836
AA seq 726 aa
MPSLSFLRFLSGRSLADVCDGVKRRLGLGDDEGRDEEAGLAGGSSRPAAAAAVAGPPGEC
YACTQPGVPSFHSTTCDQVHSPDWDADAGSSLVPVQAQPSAAHHAAAAAARWVFGPVLDP
RSKRVQRWNRWILLARAAALAVDPLFFYALSIGRAGQPCVYMDAGLAAAVTALRTAADLA
HLAHVLLQFRVAYVSRESLVVGCGKLVWDPRAIAAHYARSLKGLWFDLFVILPIPQVIFW
LVIPKLIREEQIKLIMTMLLLLFLLQFLPKVYHSIYIMRKMQKVTGYIFGTIWWGFGLNL
FAYFIASHIAGGCWYVLAIQRVASCLQEECKIKNTCNLTSLACSKEMCFHLPWSDKNGLA
CNLTSFGQQNIPDCLSGNGPFAYGIYKGALPVISSNSLAVKILYPIFWGLMTLSTFGNDL
EPTSNWLEVIFSIINVLSGLMLFTLLIGNIQVFLHAVLARKRKMQLRFRDMEWWMRRRQL
PSRLRQRVRKYERERWAAITGDEEMEMIKDLPEGLRRDIKRYLCLELVKQVPLFHGMDDL
ILDNICDRLRPLVFSSGEKVIREGDPVQRMVFVLQGKLRSTQPLAKGVVATCMLGAGNFL
GDELLSWCLRRPSLDRLPASSATFECVETAQAFCLDAPDLRFITEQFRYKFANEKLKRTA
RYYSSNWRTWAAVNIQLAWRRYKARTTTDLASAAQPPSAGGPDDGDRRLRHYAAMFMSLR
PHDHLE
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgccttccctctccttcctccgcttcctctccgggaggtcgctcgcggatgtgtgtgat
ggggtgaagaggaggcttggattgggggatgatgaaggccgggacgaggaggctggtctg
gccggagggtcgagccgtccggcggcggcggcggcggtggcggggcctcccggcgagtgc
tacgcgtgcacgcagcccggggtgccgtcgttccactccacgacgtgcgaccaggtgcac
tcgccggactgggacgcggacgcgggctcgtcgctagtgccggtccaggcgcagccgtcg
gcggcgcaccacgcggcggcggcggcggcgcggtgggtgttcggcccggtgctcgacccg
cggagcaagcgcgtgcagcggtggaaccggtggatcctgctggcccgcgccgccgcgctg
gcggtggacccgctcttcttctacgcgctctccatcggccgcgccgggcagccgtgcgtg
tacatggacgccggcctcgccgccgccgtcacggcgctccgcaccgccgccgacctggcg
cacctcgcccacgtcctcctccagttccgcgtcgcctacgtctcccgcgagtccctcgtc
gtcggctgcggcaagctcgtctgggacccccgcgccatcgccgctcactacgcccgctcc
ctcaagggcctctggttcgatctcttcgtcatcctgcccatcccacaggtcatcttctgg
ctagtcataccgaagttaatcagagaagagcaaatcaaacttatcatgacaatgctgctg
ctcttattcttgctgcaatttctccccaaggtgtaccacagtatttatatcatgaggaaa
atgcagaaggtgactggttacatctttggaacgatatggtggggattcgggcttaatctt
ttcgcctatttcattgcttctcacatcgcaggtggatgttggtatgtccttgcgattcag
cgtgtcgcctcctgcctccaggaggaatgcaagataaagaacacttgcaacctaacatca
cttgcttgctccaaggagatgtgttttcaccttccttggtcagataagaatggactggca
tgcaacttgacttcttttggccaacaaaacattccagactgtctaagcggcaatgggccc
tttgcttatggaatctacaaaggggctctgcctgttatttccagcaattcacttgctgtt
aaaatactctaccctatattttggggactcatgactctcagtacttttggtaatgatctt
gagcctacaagcaattggcttgaggtgattttcagcataatcaatgtacttagcgggttg
atgctcttcacattgctgattggaaacatacaggtcttcttgcatgctgtcttagcaaga
aagcgaaagatgcagctgcggttccgggacatggaatggtggatgcggcggaggcagttg
ccgtcccgcctgaggcagagggtccggaagtacgagcgtgaacgctgggcggccatcacg
ggagatgaggagatggagatgatcaaggacctgcctgaagggctcaggcgagacatcaaa
cgctacctctgcctcgagctagttaaacaggttcctctgttccatggcatggacgatctc
atcctggacaacatctgcgacaggctgaggccgctggtgttctccagcggcgagaaggtg
atccgggagggcgacccggtgcagcggatggtgttcgtcctccaggggaagctccggagc
acgcagccgctggccaagggcgtggtggcgacgtgtatgctcggcgccggcaacttcctc
ggcgacgagctgctgtcgtggtgcctccggcggccgtccctggaccggctgccggcgtcg
tcggcgacgttcgagtgcgtcgagacggcgcaggcgttctgcctcgacgcccccgacctt
cgcttcatcacggagcagttccggtacaagttcgccaacgagaagctcaagcggacggcg
cgctactactcctccaactggcggacgtgggcggccgtcaacatccagctcgcgtggcgc
cggtacaaggcaaggacgacgaccgacctggcgtcggcggcgcagccgccgtccgccggc
gggcccgacgacggggaccgccggctccgccattacgcggccatgttcatgtcgctcagg
ccacacgatcacctcgagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4337181
Entry
4337181           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 6
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4337181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4337181
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4337181
SSDB
Motif
Pfam: Ion_trans cNMP_binding
Other DBs
NCBI-GeneID: 4337181
NCBI-ProteinID: XP_015635885
UniProt: Q7X641
LinkDB
Position
4:32752482..32758738
AA seq 724 aa
MFDSAHKAQYIDGQREMFKRLDESSPRSSVPSEVGGRSTLKFSMPSFGYDSFNPVRSFLS
GVRKGSGRLKSLRQSLTSGAPKTAFAEDLKSFKKTIFDPQEKFLFQMNWFCFLSCVFAVA
VDPLFFFLPIIDGDDKSSCIGIDKKLAVTSTIIRTILDLVYLIRVFLQFRTAYVAPSSRV
FGTGELVIDPMRIAIRYLKSYFVMDFFALLPLPQIVVWRYLHTLDGPDVPSTKNALVWVV
LFQYIPRLLRIFPVTKDLKRTAGVFIETAWLGAAYYLLWFMLAGHNVGTLWYFLTIERED
SCWRSNCHSNDGCNKSYLYCSDNHTGNYTSWLSKRTELLSACSTNSFQFGIFEQALVSGI
LRPGNFISKICYCFWWGLQNLSTLGQGLQTSIYPGEVLFSIAICVIGLILFALLIGNMQT
YLQSVAIRLEEMRVKKRDAEQWMHHRSLPPQIRERVRRYERYRWLETRGVDEENLVQTLP
KDLRRDIKRHLCLGLVKRVPLFENMDERLLDAICERLRPTLYTENEYILREGDPVDEMHF
ILHGCLESETTDGGRSGFFNKVQLKEGAFCGDELLTWALDPKSAANFPASTRTVKALTEV
EAFALCAEELKFVASQFRRLHSRQVQHTFRFYSQHWRTWAACFIQAAWRRYYKRKMAEQH
RKEEEAANRQSSSSHHPSLAATIYASRFAANALRGVHRLRSRASPTIVRLPKPPEPDFAV
DEAD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgtttgattctgcgcacaaagctcaatacatcgacggacaaagagaaatgtttaagaga
ttggatgagtcaagccctaggtcatctgtaccttctgaagtgggagggaggagcaccctg
aagtttagcatgcctagttttggttatgattcatttaatcccgtaagatctttcttgtca
ggggtgagaaagggttctggaagacttaaatcacttcggcaatcacttacatctggtgct
cctaagacagcttttgcggaagatcttaaatcttttaagaagactatatttgatccccag
gaaaagtttctctttcaaatgaattggttttgcttcctatcatgtgtttttgctgttgcc
gtggatccactatttttcttcctacccattatcgacggcgacgacaagtccagttgcatt
ggtattgataaaaaattggcagtgacatcaacaataatacgaacaattctggatctggtc
tatcttatacgtgtatttcttcaatttcgcactgcttatgttgctccatcttctcgagtg
tttggaactggtgagcttgtgattgatccaatgaggattgctattcggtacttaaagagt
tattttgtaatggacttctttgctttgctaccacttccacagattgttgtttggagatat
ctccatactttggatggtccagatgtaccgtcaacaaaaaatgcattggtttgggttgta
ttgtttcaatatattccaaggttgctacggattttccctgtgaccaaagatttgaaaagg
acggctggtgttttcattgaaactgcttggcttggtgctgcttactatcttctatggttt
atgctggctggtcataatgttggtactttgtggtattttttgaccatagagcgggaagat
tcttgctggcgctcgaactgtcatagcaatgatggctgtaataaaagctacctgtactgt
agtgataatcatactggcaactataccagttggcttagtaagagaacagaacttctcagt
gcatgcagtactaattctttccaatttggtatttttgaacaagcgctggtgtctggaata
cttcgtccaggaaattttatctctaaaatctgctattgcttctggtgggggctacaaaat
ctaagtacccttggtcaagggcttcaaacaagcatatatcctggagaggtgttattctct
atcgcaatatgtgttattgggctaattctttttgctctcctcatcggcaacatgcagacc
taccttcaatcagttgctatacggcttgaagagatgagagttaagaaacgtgatgctgag
cagtggatgcatcatcgttcactgcctcctcaaataagagagcgagtaaggagatatgaa
cgctataggtggttggagaccagaggagtagatgaagaaaatttggttcaaacccttcca
aaagaccttcggagggacattaagcgccatctctgtttgggtttagtgaaaagggtacct
ttgtttgagaatatggacgaaagattgctggatgcaatatgtgagaggttaaggcctaca
ctatacactgaaaatgaatacattttgagagaaggcgatcctgtggatgagatgcatttc
atcctccatggctgcttggagagtgagaccaccgatgggggccgaagtggattctttaac
aaggtccagttaaaggagggcgctttctgcggtgatgagctgctcacatgggcattggat
cctaaatctgctgctaacttcccagcttcaactaggacagtgaaagctcttactgaggtt
gaggcatttgcgttgtgtgctgaggagctgaaatttgtggccagtcagttcaggaggctc
cacagtaggcaagttcagcacacgttccggttctattcccagcactggaggacatgggcg
gcctgtttcattcaagcggcatggcgccgctattacaagaggaagatggccgagcagcat
cgcaaggaagaagaggctgcaaaccggcaaagcagcagcagccaccaccctagcctcgca
gcaaccatctacgcatctcgctttgcagctaatgcactccgaggagttcacaggctcaga
agcagggccagcccgacaattgtgagattgccaaagcctccagaaccagattttgccgtc
gatgaagctgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339240
Entry
4339240           CDS       T01015                                 
Name
(RefSeq) cyclic nucleotide-gated ion channel 4
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4339240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4339240
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4339240
SSDB
Motif
Pfam: Ion_trans cNMP_binding
Other DBs
NCBI-GeneID: 4339240
NCBI-ProteinID: XP_015637795
UniProt: A0A0P0WP96 Q60EI8
LinkDB
Position
5:24711951..24716686
AA seq 691 aa
MSGELSTRASTSSSSSSPPGDARGPEHGGTPRGEVSSKRRLVLRRRQRWRRLGGGAAASW
AAADPRARWVREWNRAYLLACAAGLMVDPLFLYAVSLSGPLMCVFLDGWLAAAVTALRCM
VDAMHAWNIVTQLRVSRAGRERACAAGPDEEQPEAEAAAPAPAADADAAASNKLRDHGRY
RKWLVLDFFVILPVMQVVVWVAAPAMIRAGSTTAVMTVMLVAFMLEYLPKIYHSVVFLRR
MQNQSGHIFGTIWWGIALNLIAYFVAAHAVGACWYLLGVQRATKCLKEQCLLAGLPACAS
STAAVACVDPLYYGAAVASVGGDRLAWGGNATARNVCLSSGDNYQYGAYKWTVMLVSNPS
RLEKMLLPIFWGLMTLSTFGNLESTTEWVEIVFNIMTITGGLILVTMLIGNIKVFLNATT
SKKQAMQTRLRGLEWWMEHKGVPHGFRQRVRQFERQRWAATRGVDECQIVRDLPEGLRRD
IKYHLCLDLVRQVPLFHHMDDLVLENICDRVKSLIFPKGEIIVREGDPVQRMLFIVRGHL
QCSQVMRNGATSWCTLGPGNFSGDELLSWCMRRPFMERLPASSSTLVTAESTEAFGLEAG
DVKYVTQHFRYTFTSDKVRRSARYYSHGWRTWAAVAVQLAWRRYKHRKTLASLSFIRPRR
PLSRCSSLGEEKLRLYTAILTSPKPNQDDDF
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgtcaggcgagctctccacgcgcgcgtcgacctcctcgtcgagcagctcccctcccggc
gacgcgcgggggccggaacatggagggacgccgcgtggcgaggtgtcgtccaagcgccgt
ctggtgctgcggcggcggcagcggtggcggcgtctcggcggcggcgccgcggcgtcgtgg
gcggcggcggacccgcgggcgaggtgggtcagggagtggaaccgcgcgtacctgctggcc
tgcgcggcggggctcatggtggacccgctgttcctgtacgccgtgtcgctgagcgggccg
ctcatgtgcgtcttcctcgacggctggctcgccgccgcggtcaccgcgctccggtgcatg
gtggacgccatgcacgcgtggaacatcgtgacgcagctccgcgtctcgcgcgccgggcgg
gagcgggcgtgcgccgccggccccgacgaggagcagcctgaggctgaggccgcggcgccg
gcgccggcggcggacgcggacgccgccgcgagcaacaagctccgtgaccacgggaggtac
aggaaatggttggtgctggatttcttcgtcattctccccgtgatgcaggtggtggtttgg
gtggcggcgccggcgatgatacgggcggggtcgacgacggcggtgatgacggtgatgctg
gtggcgttcatgttggagtacctgccaaagatctaccactccgtcgtcttcctccgccgg
atgcagaaccagtccggccacatcttcggcaccatctggtggggcatcgccctcaacctc
atagcctacttcgtcgccgctcacgcggtgggcgcgtgctggtacttgctgggggtccag
agggccaccaagtgcctgaaggagcagtgcttgcttgccgggctgccggcgtgcgcgtcg
tccacggcggcggtggcgtgcgtcgacccgctgtactacggcgccgccgtggcgtccgtc
ggcggcgaccggctcgcctggggcgggaacgcgacggccaggaacgtgtgcctcagcagc
ggcgacaactaccagtatggcgcgtacaagtggaccgtcatgctcgtctccaaccccagc
cgcctcgagaagatgctcctccccatcttctggggcctcatgaccctcagcacgtttggg
aatctggagagcacgacggagtgggtggagatcgtgttcaacataatgacgatcacgggg
ggcctgatcctggtgacgatgctgatcgggaacatcaaggtgttcctgaacgcgacgacg
tcgaagaagcaggcgatgcagacgcggctgcgcgggctggagtggtggatggagcacaag
ggggtgccgcacgggttccggcagcgggtgcggcagttcgagcggcagcggtgggcggcg
acgcgcggggtggacgagtgccagatcgtccgcgacctccccgagggcctccgccgcgac
atcaagtaccacctctgcctcgacctcgtccgccaggtccccctcttccaccacatggac
gacctcgtcctcgagaacatctgcgaccgcgtcaagtccctcatcttccccaagggcgag
atcattgtgagagaaggggacccggtgcagaggatgctgttcatagtgagggggcacctg
cagtgcagccaggtgatgaggaacggggcgacgagctggtgcacgctggggccggggaac
ttcagcggggacgagctgctgtcgtggtgcatgaggcggccgttcatggagcggctgccg
gcgtcgtcgtcgacgctggtgacggcggagagcacggaggcgttcgggctggaggccggc
gacgtcaagtacgtgacgcagcacttccggtacaccttcaccagcgacaaggtgcggcgc
agcgcgcggtactactcccacgggtggcggacgtgggcggccgtcgccgtgcagctcgcg
tggcggcggtacaagcaccgcaagacgctcgcctcgctctccttcatccgcccgcgcagg
ccgctctcgcggtgctcgtccctcggggaggagaagctcaggctctacaccgccatcctc
acctcccccaagcccaaccaggacgacgacttctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340354
Entry
4340354           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 17
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4340354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4340354
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4340354
SSDB
Motif
Pfam: Ion_trans cNMP_binding IQ UBM
Other DBs
NCBI-GeneID: 4340354
NCBI-ProteinID: XP_015643413
UniProt: Q69KL7
LinkDB
Position
6:4436995..4442850
AA seq 685 aa
MFGSRRVKDEMELRKQRTVRFHEERAKPTIPTHQKQAGLATSKLGLGISEKNKIFLAGNE
LWYKKIIDPSSDFILTWNYVLRIACFVALFMDPLYFYVPKIYYGTPNSCIGRDTRLAIIV
TVFRSITDLFYVLQIIIKFRTAYINPSSTLGVFSRGDLVTDPGNIAKHYLRSSFVVDLVA
SLPLPQIIIWSVIPSVKYSLSEHDDDILLLIALFQYVLRLYLVFSLNSKIVEVTGAFSKT
AWQGAAYNLLLYMIASHVLGALWYLLSVDRQTACWEKYCSKEAGCQNRYLACDIQSDSNW
KISTAIFNKCDATNKTIDFDFGMFTPLLSNQAPDQGFLKKFFYCLWWGLQNLSCYGQTLT
VSTYIGETLYAIFLAVLGLVLFAHLIGNVQTYLQSITARVEEWRIKQRDTEEWMRHRQLP
QKLRERVRRFVHYKWLATRGVDEESILKALPADLRRDIKRHLCLDLVCRVPFFSQMDGQL
LDAICERLVSSLSTVGTYIVREGDPVTEMLFIIRGKLESSTTDGGRTGFFNSITLKTGDF
CGEELLGWALVPKPTVNLPSSTRTVKTIVEVEAFALRAEDLKFVASQFRRLHSRKLQHTF
RYYSHHWRTWAACFIQAAWRRYKRRRLAKDLSIRESFFSRRSFEDDGSPEHSLVLNAVRK
GAHIIKELPKFRKPSEPDFSAEHDD
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgtttgggtcgaggagggtgaaggacgagatggagctcaggaagcagaggaccgtgaga
ttccacgaggagagagcaaaaccaactatacccactcaccagaagcaggctgggctagct
actagtaagcttggcctggggatttcggagaagaacaagatttttctagcagggaatgag
ctttggtacaagaaaattattgacccatcaagtgatttcatcttgacatggaactatgtc
ctccgtattgcatgcttcgtggctctatttatggatccactgtacttctatgtacctaaa
atctattatggcactccgaattcatgtatcgggagagatacacgcctagccatcatcgtt
actgtcttccgatcaattaccgaccttttttatgttcttcaaattataataaagttcagg
actgcatatattaatccaagctccacgttaggggttttcagtcgaggagaccttgtcaca
gatcctggtaatatcgcaaagcattatttgagatctagctttgtggttgatctagtggct
tccttgcctctaccgcagatcatcatctggtctgtgataccatccgtcaaatattctttg
tcagaacatgacgatgatatactgcttctgattgctctttttcagtatgttctaagatta
tacctcgtattttcattgaactctaaaattgttgaagttaccggagcattttcaaagacg
gcttggcaaggagctgcttacaatcttctattatacatgattgctagtcatgttttagga
gcattatggtacttgctatctgttgatcgccagaccgcgtgttgggaaaaatactgtagc
aaagaagcgggctgccaaaacagatacctggcctgtgatatacagtctgattcaaattgg
aaaatcagcaccgctatcttcaataaatgtgatgccactaacaaaacaattgattttgac
tttggtatgttcacaccattattatcaaatcaagctcccgatcagggcttcctgaagaag
ttcttctattgcctttggtggggtttgcagaatctaagttgctatgggcagactctgact
gtgagtacttatattggtgagacgctgtatgctatattcttggcagttcttggtctcgtc
ttgtttgcgcatttgattggaaatgtgcagacctacctgcaatctatcactgcaagagtt
gaggagtggagaataaagcaaagagatacggaagaatggatgaggcatcggcaacttcct
cagaaactaagagaaagagtgagaagatttgttcactacaagtggcttgcgactagaggt
gtggatgaagaatctatattgaaggctttgcctgcagatcttcgccgtgacattaagcgt
cacctttgcctggatcttgtttgccgggtcccttttttctcccagatggatggtcaactt
ctggatgccatctgtgagcgtcttgtatcttccttgagcacagtgggcacatacattgtc
cgtgaaggtgacccagtgacagagatgctttttatcattcgtgggaaactggaaagctcc
actactgatggtggccggacgggcttcttcaattctataacgctcaaaactggcgatttt
tgtggtgaagaattgcttggatgggctcttgttcccaagcctactgtcaacctgccatcc
tccaccaggacggtgaagacaatcgttgaagtggaggcatttgccctccgagctgaagat
ctcaagtttgttgcgagccaattcaggcggctccacagcaggaagttgcaacacacattt
cgctactactctcaccactggaggacatgggccgcttgtttcatccaagcagcttggcgc
cgctacaagaggaggaggctggccaaggacctaagcataagggagtcattcttttccagg
agatcattcgaagatgatggttcccctgagcacagccttgtgttgaatgcagtcaggaaa
ggagcccatatcattaaagaacttcctaagtttaggaagccttctgagccagacttctca
gctgagcatgacgactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340443
Entry
4340443           CDS       T01015                                 
Name
(RefSeq) probable cyclic nucleotide-gated ion channel 20, chloroplastic
  KO
K05391  cyclic nucleotide gated channel, plant
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4340443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:osa04040]
    4340443
Ion channels [BR:osa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   4340443
SSDB
Motif
Pfam: Ion_trans cNMP_binding
Other DBs
NCBI-GeneID: 4340443
NCBI-ProteinID: XP_015644050
UniProt: A3B9H5 A0A8J8XS48
LinkDB
Position
6:complement(5461016..5471938)
AA seq 735 aa
MSGQERDDVPMLELQRFPTRSVSMCIPVRDDIYEDSIISHSGPIFTPAPTQYTSVAIPSG
NRDMLDKLPRPKVKSKPHVVTPEEVGISNWPYDQHVPKNKHLMMYSEPLGLCDNPDCVDC
PRACKNKRHFQRSLAPFDNKFHNILYGYGDRWKKKAGHYLSYIPIMKPHDKAVHRWNQFF
VISCLLAIFNDPLFFFLLSVDKDYKCIVFNWNFAIALAVGRSVTDAIYFLHMLLQFRLAY
VAPESRVVGTGDLVDEPMKIAMRYLRGFFVLDLFVVLPLPQVMILLVIPKYVGLSSANYA
KNLLRATVLLQYVPRIIRFVPLLGGQSTNGFIFESAWSTFVINLLMFVLAGHVVGSCWYL
FGLQRVNQCLRDSCAASNISKALCNNCTDCGITGINRTNWLNNSDLTGCFDTKSGNFPYG
IYQQAVLLTTEPGLKRYIYSLFWGFQQISTLAGNLIPSYFVWEVIFTMAIIGLGLLLFAL
LIGSMQNFLQALGKRRLEMQLRRRDVEQWMSHRRLPEDLRRRVRSAERFSWVATRGVNEE
ELLSNLPEDIQRGIRRHFFGFLKKVRLFNLMDNATWDAICDKLRQNLYITGSDILYQGGP
VEKMVFIVRGRLESISADGNKSPLQEGDVCGEELLSWYLEQSSVNRDGGKIKLHGMRLVA
IRTVRCLTNVEAFVLRARDLEEVTSQFSRFLRNPLVLGTIRYESPYWKNLAANRIQVAWR
YRKRRLKRAEMQRLQ
NT seq 2208 nt   +upstreamnt  +downstreamnt
atgtctggccaagagagagatgatgttccaatgctagagctacaaagatttcctactaga
agtgtatcgatgtgtatacctgtcagggatgatatatatgaagactcaatcatatcccac
agtggtcctattttcaccccagcaccaactcagtatacatccgtggctattccatcagga
aacagagacatgctcgataagctgcctcgtccaaaggttaagagcaaaccacatgttgtt
acgccggaagaagttggaataagtaactggccttatgaccagcatgttccgaagaacaaa
cacctgatgatgtactctgagcctctgggactgtgtgataatcctgattgtgtcgactgt
cctcgtgcttgtaaaaacaaaaggcatttccagagaagtttagctccgtttgataacaag
tttcacaacattctttatggctacggtgatcgatggaagaagaaagctgggcattacctt
tcatacattccaattatgaagccacatgataaggctgttcatcggtggaaccagtttttt
gtgatatcatgcttgctagccatattcaatgaccctctgtttttcttcctattgtcagta
gataaggattataagtgtatagtgttcaactggaatttcgcgatagcattagctgttgga
agaagtgtgactgacgccatatattttttacacatgcttcttcagttcaggctagcatat
gtagcaccggagtcgagagtagtgggaactggagatttggttgatgagcctatgaaaatt
gctatgcgctatcttcgtgggttttttgtactcgacttatttgttgttcttccactccct
caggtgatgatattgctagttatccctaaatatgtgggattatcaagtgcaaactatgca
aaaaacttgttgcgtgctacagttcttcttcagtatgtaccacgtattataagatttgtg
ccactgcttggtggtcaatctacaaatggattcatttttgagtcagcatggtctactttt
gtgatcaatcttctaatgtttgttttggctgggcatgtcgttggttcatgttggtacctc
ttcggactacaaagggttaatcaatgtctacgggattcttgtgctgcatcaaacatatca
aaagcgttgtgtaataattgtacagattgtggaattactggaataaataggaccaattgg
ttgaacaactcagacttaactggctgttttgatactaaaagcggtaatttcccttatggc
atctaccaacaggcagtgttgctaaccacagaacctggacttaagcgttatatatattcg
ctcttttgggggtttcagcaaattagtacattagctggcaatttgatcccaagttacttt
gtatgggaagtaatattcactatggctattattggactggggttgttgcttttcgcatta
ctcatagggtccatgcagaattttctccaagctcttggaaaaaggagactagagatgcaa
ttaagaaggcgtgatgttgaacagtggatgagccataggcggctgccagaagatctgaga
aggagggttagatctgccgagaggttcagctgggtagctactagaggagtgaatgaagaa
gagcttttgagcaatttgccagaagatattcaaaggggcatacgccgccatttctttggg
ttccttaagaaggtccggctgtttaacctgatggacaatgcaacctgggatgcaatttgt
gacaagctaaggcagaacttgtatattacaggaagtgatattctttatcagggtggtcct
gttgaaaagatggtttttatagtcaggggtagattggaaagcatcagtgcagatggaaat
aagtctcccttgcaagaaggagatgtttgtggtgaggaactcctttcctggtacttggag
caatcttcagtgaaccgagatggtgggaagatcaagttgcatggcatgcgtttggtcgcc
atacgtactgtcagatgtttaacaaatgttgaagcttttgtactgcgagcacgtgatctg
gaagaagtgacttcacaattttcaagattcttgcgcaatccacttgtgctaggtacaatc
aggtatgaatcaccttactggaagaaccttgcagcaaatcgcatccaagtcgcatggagg
tatcggaaaaggcgactgaagagagctgagatgcaaaggttgcaatag

DBGET integrated database retrieval system