KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328914
Entry
4328914           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S15a-5
  KO
K02957  small subunit ribosomal protein S15Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328914
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328914
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4328914
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-GeneID: 4328914
NCBI-ProteinID: XP_015625482
UniProt: Q6EN44 A3A565
LinkDB
Position
2:complement(8766837..8769300)
AA seq 129 aa
MGRRILNDALRTMVNAERRGKATALLQPISGVMVSFLNIMKHRGYIKKFEVIDPHRVGKI
NVELHGRIKDCKALTYRQDIRAKEIEQYRVRMLPTRQWGYVVITTPNGVLDHEEAIKQNV
GGQVLGYFH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggggcggcggatcctgaacgacgcgctgcggacgatggtgaacgcggagcggaggggg
aaggcgacggcgctgctgcagcccatctccggcgtcatggtctccttcctcaacatcatg
aagcaccgagggtacattaaaaagtttgaggtcatcgatccccatagagttggaaaaatc
aatgtagagcttcatggaaggattaaagattgtaaggctcttacttataggcaggatatt
agagccaaggaaatagaacaatacagagttcggatgcttccaacacggcagtggggctat
gtcgtgatcacaactccaaatggtgtactggatcatgaggaagcaattaagcagaatgtg
ggcgggcaagtgcttggttattttcattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329361
Entry
4329361           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S15a-1
  KO
K02957  small subunit ribosomal protein S15Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329361
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329361
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4329361
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-GeneID: 4329361
NCBI-ProteinID: XP_015622799
UniProt: Q6K5R6 A0A0P0VJ25
LinkDB
Position
2:16440223..16442471
AA seq 130 aa
MVRVSVLNDALKTMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGK
IVVELNGRLNKCGVISPRFDVGVKEIESWTARLLPSRQFGYIVLTTSAGIMDHEEARRKN
VGGKVLGFFY
NT seq 393 nt   +upstreamnt  +downstreamnt
atggtgagagtcagtgtcctcaacgatgctctgaaaacaatgtacaatgctgagaagcgt
gggaagcggcaagtgatgatccgaccctcatcaaaggttatcatcaagtttctcatcgtg
atgcagaagcacggctacattggtgaatttgagtttgttgatgaccaccgctctggcaaa
attgttgttgagctgaacggacgcctcaacaagtgtggtgtcatcagccctcgcttcgat
gttggtgtcaaggaaatcgaatcatggactgcgaggctgcttccctccagacagtttggg
tacattgtccttactacttcagctggcattatggaccatgaggaggctcgcagaaagaac
gttggtgggaaggtcctcggtttcttctactag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342697
Entry
4342697           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S15a-1
  KO
K02957  small subunit ribosomal protein S15Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4342697
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4342697
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4342697
SSDB
Motif
Pfam: Ribosomal_S8
Other DBs
NCBI-GeneID: 4342697
NCBI-ProteinID: XP_015644608
UniProt: A3BHP2 Q84ZP1
LinkDB
Position
7:complement(5819749..5821823)
AA seq 130 aa
MVRVSVLNDALKTMYNAEKRGKRQVLIRPSSKVIIKFLIVMQKHGYIGEFEFVDDHRSGK
IVVELNGRLNKCGVISPRFDVGVKEIESWTARLLPSRQFGYIVLTTSAGIMDHEEARRKN
VGGKVLGFFY
NT seq 393 nt   +upstreamnt  +downstreamnt
atggtgagagtcagtgtcctcaatgacgctctgaaaaccatgtacaatgctgagaagcgt
ggtaagcgccaagttcttatccggccctcgtcaaaggtgatcatcaagttcctcatcgtc
atgcagaagcatggttacattggtgagtttgagtttgttgatgaccaccggtctggcaag
atcgtggttgagctgaatggacgccttaacaagtgtggtgtcatcagcccacgctttgat
gttggtgtcaaggaaatcgagtcctggactgctaggctgcttccctcccgtcagtttggg
tacattgtccttaccacctctgccggaatcatggaccacgaagaagcgaggcggaagaac
gtcggaggcaaggtgctcggctttttctactag

DBGET integrated database retrieval system