KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328930
Entry
4328930           CDS       T01015                                 
Name
(RefSeq) cyclic pyranopterin monophosphate synthase, mitochondrial
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa04122  Sulfur relay system
Module
osa_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4328930
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    4328930
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     4328930
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14 Radical_SAM_2
Other DBs
NCBI-GeneID: 4328930
NCBI-ProteinID: XP_015626834
UniProt: Q0E297 A0A0P0VH78
LinkDB
Position
2:complement(8976771..8981150)
AA seq 394 aa
MMMMPLRCLSELARRRPDRAVDAMRVGLRCLMSTCPLSKATDDSQRLYATSSCANVPEVA
LSEAPLSDMLVDSFGRFHNYLRISLTERCNLRCQYCMPAQGVQLTPNSELLSHDEIIRVA
GLFVTSGVDKIRLTGGEPTIRKDIEDICLHLSGLKGLKTLAMTTNGLVLSKKLPRLKECG
LNALNISLDTLVPAKFEFMTRRKGHSRVMESIDASIQLGFQSVKVNCVVMRGMNDDEICD
FVEMTRDKPVNVRFIEFMPFDGNVWNVKKLVPYAEMMDKVRQRFKGVERLQDHPSETAKN
FKIDGHAGTISFITSMTEHFCAGCNRLRLLADGNLKVCLFGPSEVSLREPIRAGVDDAGL
REIISAAVKRKKAKHAGMFDIAKTANRPMIHIGG
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgatgatgatgccgctgcgttgcctctccgagctggcccgccgccggcctgatcgcgcg
gttgatgcaatgagagtggggctccgatgtttgatgagcacttgcccgttatccaaagct
actgatgatagtcaaaggttatatgcaacttcttcttgtgctaatgtgccagaggtagca
ctgagtgaggcgccactgtcagacatgcttgtcgattcgttcgggagattccacaactac
ctgaggatctccttgaccgagcgctgtaatctgagatgccagtactgcatgcctgcccaa
ggagttcagctcacgccaaactcagagctcctgtcgcatgatgagataatccgagttgcc
ggcctgttcgttacttctggtgtggataagatccggttgaccggcggagaaccaaccatt
agaaaggatatcgaggatatctgtttgcatctttccggcttgaaggggctgaaaactctt
gcgatgaccacgaatgggctcgttctttctaagaagctcccaaggttgaaagaatgtggg
ctcaatgctctaaatattagcttggacacgttggtccctgcaaagtttgagttcatgaca
agacgtaaagggcactcgagagtcatggaatcgatagatgcttctatacaacttggattc
caatctgtcaaggtcaactgcgttgtcatgcgtggaatgaatgatgacgagatctgtgat
tttgttgaaatgacgagagacaagcctgtcaatgtcagatttatagagtttatgccgttt
gatggtaatgtttggaatgtcaagaagttggttccttatgcagagatgatggataaagtg
cgccaacgttttaaaggtgtagagagacttcaagatcatccgtcagagaccgcaaagaat
ttcaagattgatggtcatgctggaacaatttcgtttattacatcgatgacagagcatttt
tgtgctggttgcaatagattacgactattggctgatggcaacttgaaagtgtgcttattt
ggcccctcagaggtgagcctgagagagcctattcgagctggtgttgatgatgctggactc
agagaaataataagcgctgcggttaaaaggaagaaagctaaacatgctgggatgtttgat
attgctaagacggcaaatagacctatgattcacattggtggctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352298
Entry
4352298           CDS       T01015                                 
Name
(RefSeq) cyclic pyranopterin monophosphate synthase, mitochondrial isoform X1
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00790  Folate biosynthesis
osa01100  Metabolic pathways
osa01240  Biosynthesis of cofactors
osa04122  Sulfur relay system
Module
osa_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    4352298
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    4352298
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     4352298
SSDB
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_12 Fer4_14 Radical_SAM_2
Other DBs
NCBI-GeneID: 4352298
NCBI-ProteinID: XP_015620644
LinkDB
Position
12:19452063..19456651
AA seq 498 aa
MHRGSHIHAGWAAPSNHQPLTCPARKGHSASASASASPSIAAAARRRVSRRGAGIGLDLG
LGLKAAVSCFYFLEKVTILVIKPVAGLRGGEGIDSLCQTMMMPLRCLSELARRRRGCCRP
DHAVDAMRAGLQCLMSTCSSTKATDNHSFSNTYATSCANLPEVAPSEAPLSDMLVDSFGR
FHNYLRISLTERCNLRCQYCMPAEGVELTPSSELLSHDEIIRVADLFVTSGVDKIRLTGG
EPTIRKDIEDICLHLSGLKGLKTLAMTTNGLVLSKKLPRLKECGLNALNISLDTLVPAKF
EFMTRRKGHSRVMESIDAAIELGFQSVKVNCVVMRGMNDDEICDFVEMTRDKPVNVRFIE
FMPFDGNVWNVKKLVPYAEIMDKVRQRFNGVERLQDHPSETAKNFKIDGHAGTISFITSM
TQHFCAGCNRLRLLADGNLKVCLFGPSEVSLREPIRAGVDDAGLREIISAAVKRKKAKHA
GMFDIAKTANRPMIHIGG
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgcaccgtgggtcccacatccacgccgggtgggctgcaccgagtaaccaccaacccttg
acctgcccagctcggaaaggccactccgcctccgcctccgcctccgcctctccatccatc
gccgccgccgcgcgccgccgcgtgagccgccggggggcgggcattggattggacttgggg
ttagggctaaaagcagcagtttcttgtttttacttcctggagaaagtgacgattttggtt
attaagccagtcgctggattacgaggaggagaggggatagatagtttgtgtcagacgatg
atgatgccgctgcgttgcctctccgagctggcccgccgtcgccgcggctgctgccggcct
gatcacgcggttgatgcgatgagagctgggctccaatgtttgatgagcacttgctcctca
accaaagctactgataatcatagtttctccaacacatatgcaacttcttgtgctaatttg
ccagaggtagcaccaagcgaggcgccactgtcagacatgctcgtcgattcattcgggaga
tttcacaactacctgaggatctccttgacagagcgctgtaatctgagatgccagtactgc
atgcctgcagaaggagttgagctcacgccaagctcagagctcctgtcgcacgacgagatc
attcgagttgccgatctttttgttacttctggtgtggataagatccggttgactggtgga
gaaccaaccattagaaaggatattgaagatatctgcttacatctttctggcttgaaggga
ctgaaaactcttgcgatgaccacgaatgggcttgttctttctaagaagctcccaagattg
aaagagtgtgggctcaatgctctaaatattagtttggacacgttggtccctgcaaagttt
gagttcatgacaaggcgtaaagggcactccagagtcatggaatcgatagatgctgctatt
gaacttggattccaatctgtcaaggtcaactgtgttgtcatgcgtggaatgaatgatgat
gagatctgtgattttgttgaaatgacgagagacaagcctgtcaatgtcagatttattgag
tttatgccgtttgatggtaatgtttggaatgtcaagaagttggttccttatgcagagata
atggataaagtgcgccaacgttttaacggtgtagaaagacttcaagatcatccgtcagag
acggcgaagaatttcaagattgatggtcatgctggaacaatttcgtttattacatcgatg
acacagcatttttgtgctggttgcaatagattacgattattggctgatggcaacttgaaa
gtgtgcttgtttggcccgtctgaggtgagcttgagagagcctatccgagctggtgttgat
gatgctggactcagagaaataataagcgctgcggttaaaaggaagaaagctaaacacgct
gggatgtttgatattgctaagacagcaaatagacctatgattcacattggtggctga

DBGET integrated database retrieval system