KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328932
Entry
4328932           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L21, chloroplastic
  KO
K02888  large subunit ribosomal protein L21
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328932
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328932
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4328932
  Bacteria
    4328932
SSDB
Motif
Pfam: Ribosomal_L21p PurK_C
Other DBs
NCBI-GeneID: 4328932
NCBI-ProteinID: XP_015623613
UniProt: A3A587 Q6K241
LinkDB
Position
2:complement(9005321..9007498)
AA seq 214 aa
MATATLPLRLLASKTLAFPSAPSLPASRCSLPVAASAPRRCWRLLASAEEPAPAPVEAEA
EAEVVEEEEVEEEEAAVPEPVEAQIAAAGAGKDADIFAVVMIGSRQYIVMPGRYIYTQRL
KGANVNDQIILNKVLLVSTRDKAYIGMPVVTNAAVHAVVEEQGRDDKVIVFKYKKKKKYQ
RKLGHRQPNTRLRITGISGYEDFPADPILEYVPA
NT seq 645 nt   +upstreamnt  +downstreamnt
atggccaccgcgacgctgcccctccgcctcctcgcctccaaaaccctagccttcccctcc
gccccgtccctcccggcctcgcgatgctccctccccgtcgccgcgtccgcgccccgccgc
tgctggcggctcctcgcttccgccgaggagccggcgcccgcacccgtggaggccgaggcc
gaggcggaggtggtagaggaggaggaggttgaagaagaggaggctgcggtgccggagcct
gtggaggcgcagatcgcagccgcgggcgccgggaaggacgccgacatcttcgccgttgtc
atgattgggtcgagacagtacattgtgatgcctggaaggtatatatacacgcagaggctg
aaaggcgccaatgtcaatgatcagataatattaaacaaggtattactggtatcaactaga
gacaaggcttacattggcatgccagtggtgaccaatgctgctgttcatgcagtggttgag
gaacagggacgggatgataaagtgatagtcttcaaatataagaagaagaagaagtaccag
aggaaacttggtcacagacagccaaacacaaggttaagaattaccggcataagtggatac
gaggacttccctgctgacccgatacttgagtatgttccagcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339580
Entry
4339580           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L21, mitochondrial
  KO
K02888  large subunit ribosomal protein L21
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339580
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4339580
  Bacteria
    4339580
SSDB
Motif
Pfam: Ribosomal_L21p DUF6426
Other DBs
NCBI-GeneID: 4339580
NCBI-ProteinID: XP_015639249
UniProt: Q6I600 Q0DG17
LinkDB
Position
5:complement(27756086..27759152)
AA seq 250 aa
MATRRCLLRLLSRRLLAHTPQPASLASIATRTLASLAKPLVPQASRVLASPRLFPSRCHY
ASNRSSGDEEEGDDDDHYDEEGSGDEWGEEEEEAVAAKPPSGKTEEEKVAEAAEIGYTVV
GPLGADEKPFKPYEPVFAVVQIGSHQFKVSNGDSIFTERLKFCDVNDKLILNRVLMLGSQ
SQTVIGRPTLPDATVHAVVEEHALDAKVIIFKKKRRKNYRRTKGHRQELTKLRITNIEGI
DKSEATAVAA
NT seq 753 nt   +upstreamnt  +downstreamnt
atggcgacgcggcgatgcctcctccgcctcctctcgcgccgcctcctcgcccacacccct
caacccgcgtcgctggcctcgatcgcgacgcgaaccctagcctccttggccaagcccctc
gtgccgcaggcatcccgcgtcctcgcctccccccgcctcttcccctcgcgctgccactac
gcgtcgaaccgatcctccggcgacgaggaggagggggacgacgacgatcactacgacgag
gaggggagcggggatgagtggggggaggaggaggaggaggccgtggcggcgaagcccccc
agcgggaagacggaggaggagaaggtggcggaggcggcggagatagggtacacggtggtt
ggcccgctcggtgccgacgagaagcccttcaagccctacgagcccgtgttcgccgtcgtc
cagattggttcgcatcagtttaaggtgagcaatggcgactcgatcttcacggaaaggttg
aagttttgcgatgtgaatgataagttaattttgaatcgagttctcatgcttgggtcacaa
tctcaaacagtcattgggaggccaactcttcctgatgctactgttcatgctgtcgttgag
gagcatgccctagatgcaaaggttatcatattcaaaaagaaaagaagaaaaaattaccgt
cgaacaaagggccatcgtcaggaattgacaaagctgagaataaccaacattgaaggaata
gataagtcagaggccactgctgttgctgcttaa

DBGET integrated database retrieval system