KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328954
Entry
4328954           CDS       T01015                                 
Name
(RefSeq) vacuolar protein sorting-associated protein 29
  KO
K18467  vacuolar protein sorting-associated protein 29
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4328954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4328954
Membrane trafficking [BR:osa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    4328954
 Protein recycling
  Others
   Retriever complex
    4328954
SSDB
Motif
Pfam: Metallophos_2 Metallophos
Other DBs
NCBI-GeneID: 4328954
NCBI-ProteinID: XP_015627327
UniProt: A0A0N7KF22 Q6ETY0
LinkDB
Position
2:complement(9458287..9463824)
AA seq 188 aa
MVLVLALGDLHVPHRAADLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYLKSLCPDLHIT
RGEYDEDARYPETKTLTIGQFKLGLCHGHQVVPWGDLDSLAMLQRQLDVDILVTGHTHQF
KAYKHEGGVVINPGSATGAYSSITYDVNPSFVLMDIDGLRVVVYVYELIDGEVKVDKIDF
KKTATMHA
NT seq 567 nt   +upstreamnt  +downstreamnt
atggtgctggtgctcgcgctcggggatctgcacgtgccgcaccgggcggccgacctgccg
gccaagttcaagtccatgctcgtcccgggcaagatccagcacatcatctgcacggggaac
ctctgcatcaaggaagttcatgactacctgaaaagcctttgtcctgatctccatataacc
agaggtgaatatgatgaggatgctcgttacccagagactaagacacttactattggtcag
ttcaagctagggctgtgccatggtcatcaggttgttccatggggcgatttggactccctg
gcgatgctccaacggcagctggacgtggacatcctcgtcacagggcacacccaccagttc
aaggcgtacaagcacgaggggggagtggtcatcaaccccggctccgccacgggcgcctac
agcagcatcacctacgacgtgaacccgagcttcgtgctcatggacatcgacggcctccgc
gtggtcgtctacgtgtacgagctgatcgacggcgaggtcaaggtcgacaagatcgacttc
aagaagacggcgacgatgcacgcctga

DBGET integrated database retrieval system