KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328957
Entry
4328957           CDS       T01015                                 
Name
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase 1, chloroplastic
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4328957
Enzymes [BR:osa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     4328957
SSDB
Motif
Pfam: PRAI His_biosynth DUF166
Other DBs
NCBI-GeneID: 4328957
NCBI-ProteinID: XP_015623246
UniProt: Q6ETX4 A0A8J8Y0B9
LinkDB
Position
2:9502432..9505311
AA seq 278 aa
MAAAAQATVAPSISSVARQPQRFPAPSTSGNSKFPLFKTSCLAMSHGLVSNTAVSSQPND
GAAKLIQPVVKMCGITSAKDAETALEAGAKLIGMILWPNSKRSVALAEAKEISRVAQSYG
AESVGVFVDDDEETILRVSDSCDLNLVQLHGDESRSLLHVLSKNNRIIYVLNANDDGKLI
NALPDEKYELDWFLVDSAKGGSGKGFNWQKFQMPSVRSKNGWLLAGGLHADNVCDAFYAL
KPNGVDVSSGICAPDGIRKDPTRISSFMRNVKSLGRSQ
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcggccgcggctcaagcgacggtggcgccatcaatctcgtcagtagccaggcaacct
cagcgattccctgcaccgagtactagtgggaattcgaaatttcctctatttaaaacatca
tgcttggcaatgagccatggccttgtatccaatactgctgtgtcttcacaaccaaatgat
ggagctgctaaactcatccagcctgtagtcaaaatgtgtggcatcacatcagctaaagat
gcagaaacggctttggaggccggagctaaacttattggcatgatactctggccaaactcc
aagcgttctgttgcgttagcagaagcaaaagaaatatcaagagtagcacagtcttatggg
gctgaatcagttggtgtctttgtggatgatgatgaagagaccatcttacgagtgtctgat
tcatgtgaccttaatctagtgcagcttcatggagatgaatctcgttcattacttcatgtg
ctatcgaagaacaatcgcatcatttatgttctaaatgccaatgacgacggaaagcttatc
aacgctcttcctgatgaaaaatatgagcttgattggttcttggtggatagtgccaaaggt
ggaagtggcaagggattcaactggcagaagtttcagatgccgtctgttcgaagcaagaat
gggtggcttttagctggaggccttcacgctgataatgtttgtgatgccttttatgccctg
aaaccaaatggagtggatgttagcagtggaatatgtgctcctgatggtatcagaaaagat
cccacgaggatttcttctttcatgagaaatgttaaatccttgggcagatcacaatga

DBGET integrated database retrieval system