KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328965
Entry
4328965           CDS       T01015                                 
Name
(RefSeq) chloroplast processing peptidase isoform X1
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4328965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4328965
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     4328965
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4328965
SSDB
Motif
Pfam: Peptidase_S26 DUF6426
Other DBs
NCBI-GeneID: 4328965
NCBI-ProteinID: XP_015625528
UniProt: A0A0P0VHA2 Q6ERV1
LinkDB
Position
2:9544138..9550618
AA seq 298 aa
MSSIHFFPATSQAAAPSRRPLTKPSPKPPAATAAYHRGGDNEPVLFPRLFLRRRARPAAA
PAEAPPVGPDGSSSGGGGGGGEGGGGGGDDEEDEGTRKGLLPEWLSVTTDDAKTVLAAIA
ISLAFRSFVAEPRFIPSLSMFPTFDVGDRIVAEKVTYYFRKPCINDIVIFKSPPVLQEVG
YTDNDVFIKRIVAREGDVVEVHKGKLVVNGEVRNEEFILEPPSYDMNPVQVPENSVFVMG
DNRNNSYDSHVWGPLPSKNILGRSIFRYWPPGRIGSTTTDCLIPETNPSSLIDVKLAK
NT seq 897 nt   +upstreamnt  +downstreamnt
atgtcctccatccacttcttcccggccacctcccaggccgccgccccgtcgcgccgcccc
ctcaccaaaccctccccaaaaccccccgccgccaccgccgcgtaccaccgcggcggagac
aacgagccggtgctcttcccgcgcctcttcctcaggaggcgtgcccggcccgccgcggcg
ccggccgaggcgccgccggtgggccccgacggcagcagcagcggcggcgggggaggagga
ggggaggggggcgggggcggaggggacgacgaggaggatgaggggacgaggaaggggctg
ctgccggagtggctcagcgtcacgacggacgacgccaagacggtgctggccgccatcgcc
atctcgctcgccttccgctccttcgtcgccgagccgcgcttcatcccctcgctctccatg
ttccccaccttcgacgtcggcgaccgcattgtcgccgagaaggttacatactactttaga
aagccatgtataaatgacatagtaatcttcaaaagtccaccagtgctgcaggaggtcggt
tatactgacaatgatgttttcatcaaacgaattgttgccagggagggagatgttgttgag
gttcataaaggaaaactagttgtcaatggtgaagttagaaatgaagagttcattcttgag
ccaccttcttatgacatgaacccagtgcaagtacctgagaactcagtttttgtaatggga
gataaccgaaacaacagttatgattcacatgtgtggggccctcttccttctaagaacata
ttggggagatccattttccggtattggcctcctggccgaatagggagcactactactgat
tgcctcatccctgagacaaatccaagctcgcttattgatgtcaaactggcaaagtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347239
Entry
4347239           CDS       T01015                                 
Name
(RefSeq) thylakoidal processing peptidase 1, chloroplastic
  KO
K03100  signal peptidase I [EC:3.4.21.89]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4347239
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:osa01002]
    4347239
Enzymes [BR:osa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.89  signal peptidase I
     4347239
Peptidases and inhibitors [BR:osa01002]
 Serine peptidases
  Family S26: signal peptidase I family
   4347239
SSDB
Motif
Pfam: Peptidase_S26 DUF1180
Other DBs
NCBI-GeneID: 4347239
NCBI-ProteinID: XP_015611675
UniProt: A3BZH1 Q67UZ3
LinkDB
Position
9:complement(17003038..17005689)
AA seq 411 aa
MAIRITVSYSGYVAQSLAASLGLRCSSASTAAGCRFFQDGGWRPFCMLTSSSRGHAEHHR
NGGGGGEHRREAGEGDRPKALPLSAAAGGHSLFLSPAYASSRAQPPSLAVGLLSVLAQGA
TGSKGGIYGAASLSGSSSSISLGFNPASFLPFLQTSKWLPCSDLATSSSAPPSSPSPSPP
PPAPAPSIRPKKALVSSASSSPAIARSSGGSGAAMSRSNWLSRWMSSCSDDTKTAFAAVT
VPLLYSSSLAEPRSIPSKSMYPTFDVGDRILAEKVSYIFREPEILDIVIFRAPPALQDWG
YSSGDVFIKRVVAKAGDYVEVRDGKLIVNGVVQDEEFVLEPHNYEMEPMLVPEGYVFVLG
DNRNNSFDSHNWGPLPVRNIIGRSVFRYWPPSRITDTIYEPRAEYSVAGLS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgatccgaatcacggtgtcctactccggctacgtggcgcagagcctcgccgcgtcg
ctcggcctgcgctgctcctccgcctccacggcggcgggctgccgcttcttccaggacggc
gggtggcgccccttctgcatgctcacctcctcctcccgcggccacgccgagcaccaccgg
aacggcggcggcggcggcgaacaccgccgtgaagccggggagggcgaccgcccgaaggcc
ctgccgctctccgccgccgccgggggccactcgctgttcctctcgccggcgtacgcttcg
tccagggcgcagccgccttcgctggccgtgggtttgctgtcggtgctcgcgcagggggcg
acggggtcgaagggtgggatctacggcgccgcgtctctgtcgggctcgtcgtcgtcgatc
tctctcgggttcaaccctgcctccttcctccctttcctgcagacctcgaagtggctcccc
tgcagcgaccttgccacctcctcgtctgcgccgccgtcttctccttctccttctcctcct
cctcccgcaccggcgccttcgattcgtcccaagaaggcgttggtgagtagtgcttccagc
tccccggcgattgcgaggagcagtggtggtagtggtgccgcgatgagcaggagcaactgg
ttgtcgaggtggatgagctcctgctccgacgacaccaagacggccttcgcagcggtgact
gtgcctctgctctacagctcgtcgctggccgagccgaggtccatcccgtccaagtccatg
tacccgaccttcgatgttggtgaccggattctcgccgagaaggtctcgtacatattccgg
gagccggaaatcttggacattgtgatcttccgtgcaccaccagctcttcaggattggggc
tacagctcgggtgatgttttcatcaagagagttgtggccaaggcaggcgactatgtcgaa
gttcgtgatggcaagttgattgtcaacggagtagtccaggatgaggaatttgtgttggag
cctcacaattacgagatggaacccatgcttgttccagaaggttatgtgtttgtgctggga
gacaaccgtaacaacagcttcgattcccataactgggggcctcttcctgtgaggaacatt
attggaagatctgtgtttcggtactggcctccatcaagaataacagatacaatatacgag
cctcgcgctgaatattctgtggctgggttgtcgtga

DBGET integrated database retrieval system