KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328991
Entry
4328991           CDS       T01015                                 
Name
(RefSeq) uridine kinase-like protein 3
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4328991
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     4328991
SSDB
Motif
Pfam: UPRTase PRK Pribosyltran AAA_18 CoaE Cytidylate_kin Zeta_toxin KAP_NTPase T2SSE
Other DBs
NCBI-GeneID: 4328991
NCBI-ProteinID: XP_015627173
UniProt: Q6K7V0 B9F4Y2
LinkDB
Position
2:complement(9928870..9937413)
AA seq 489 aa
MGSRPVDEVLDAAAAGVHYSTLRLDELNINGSMTGEEQPTTSGVENGHQEPFVIGVAGGA
SSGKSTVCKMIIDQLRDQRVVVVTQESFYYGLSDEELVHVHDYNFDHPDAFDTELLLSCM
ENLKHGKAVDIPNYNFKTYKSVASARKVNPSDVIILEGILVFHDSRVRDLMNMKIFVDTD
ADVRLTRRIRRDTIEKGRDIKTVLDQYSKFVKPAFEDFILPTKKYADIIIPRGGDNDVAI
DLIVQHIRTKLGQHDLCKVHPNLYVIQTTYQIRGMHTIIRDAATTTHDFIFYADRLIRLV
VEHGLGHLPFKEKQVITPTGSVYTGVEFSKRLCGISVIRSGESMENALRACCKGIKIGKI
LIHREGDNGKQLIYHNLPKDIANRHVLLLDPILGTGNSAVQAISLLLKKGVQETNIIFLN
LISAPQGVHVVSKRFPRVKIVTSEIEFGLNDDFRVIPGMGEFGDRYFGTDDYQSSTPFFC
DEKNRVRLL
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgggttcaagaccagttgatgaggttcttgatgctgccgcggctggggtccactactcc
acgctccgtttggatgagcttaacatcaatggctccatgacaggggaggaacaaccaacg
acctcaggggtggagaatgggcaccaggagccatttgtcattggtgttgccgggggtgca
tcttcaggcaaaagtactgtatgcaaaatgataatcgatcagctacgtgatcagcgtgta
gttgttgttactcaggagtctttttattatgggttgtctgatgaggaattggtccatgtt
catgattataactttgatcatccagatgcatttgatacggagttactactctcttgtatg
gagaacttgaaacatggcaaggctgtggacattcctaattacaacttcaaaacatataag
agtgttgcaagtgcaagaaaggtcaatccttcagatgtaattattttggaaggaattctg
gttttccatgattcacgtgtccgggatttgatgaacatgaagatctttgttgacacagat
gctgatgtgcgattaacaaggaggattcgacgtgacaccattgagaagggtagagatatc
aaaactgtgctagatcagtactcaaagtttgttaagcctgcttttgaagacttcatcctc
ccaaccaagaagtatgctgatattatcatcccacgaggtggcgataatgatgttgcaatt
gacttaatagttcagcatattcgtactaagcttggtcaacatgatctctgtaaagtacac
cccaatttgtatgtcattcagactacttatcagatacgaggtatgcacacaataatacgg
gatgctgccacaacaacacatgatttcatattctatgctgatcggttgattcgattggtt
gttgagcatggtcttggtcatcttccattcaaggaaaagcaggtcataactccaactgga
tcggtttacactggggtagagttctccaaaagattgtgtggtatctcagtgattagaagt
ggtgagagtatggagaatgcattgcgggcatgctgcaaaggtataaaaattgggaagatt
cttattcacagggaaggagacaatggcaaacagctaatctatcacaatttaccgaaagat
attgcaaacaggcatgtgctgttgttggatcccatactgggaacaggaaattcagctgtt
caagctatatctctactcttgaaaaagggtgtacaggaaacaaatattatttttctgaat
cttatatcagctccccaaggagtgcatgtggtcagcaagagatttccaagagtgaagatc
gtgacatcagaaatcgagtttggtctgaatgatgatttccgcgtcatccctgggatgggt
gagtttggggataggtactttgggacagatgattatcagtcatcaacaccattcttttgt
gatgagaaaaatcgtgtcaggcttttgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4330475
Entry
4330475           CDS       T01015                                 
Name
(RefSeq) uridine-cytidine kinase C
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4330475
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     4330475
SSDB
Motif
Pfam: PRK CYTH AAA_33 NB-ARC SpoIVA_ATPase AAA_24 DivIC LPP Myosin_head
Other DBs
NCBI-GeneID: 4330475
NCBI-ProteinID: XP_015627629
UniProt: Q6YV21 Q0DY93
LinkDB
Position
2:29277606..29283863
AA seq 652 aa
MDRSDSMADSPRRRNGLLRDQVQLVKRKDTNRYEIVRFPDPLSFEKGFFVMIRACQLLVQ
HNEGMIFVGVAGPSGAGKTVFTEKVLNFMPGVAVISMDNYNDASRIVDGNFDDPRLTDYD
TLLENIHGLKEGRSVQVPIYDFKMSCRTGYRTVDVPSSRIVIIEGIYALSEKLRSVLDLR
VSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKF
NPFSGFQNPMYILKSPRTITPTDIKVALGEDHTESIEETYDIYLLPPGEDPESCQSYLRM
RNREGKYNLMFEEWVTDNPFIISPRITFEVSVRLLGGLMALGYTIAAILKRKSRVFSDGK
ATVKIDWLEQLNRNYIQVQGRDRNHVKFVAEKLGLDGSYIPRTYIEQIQLEKLINDVMAL
PEDLKTKLSIDDELVSSPKEALSRVSADKRNKHLKSGLSHSYSTHGDKNIVKLSKLTETN
RRFGSGRAPEPPAINQGAITQLSEQISTLNERMDEFTSRVEELNCKFAIKKSSTSQQNLA
LPNETCNGSAPTNLFVSHLGNGTLIPHSSSSNQLLKESPIVDEINAISRGQRQVIHQLDN
LTSLLHEHLALTRQGNAVRRNGILEMDMSICPLIALTIGGFGYLVFKSLNRS
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggaccgaagtgattccatggctgattcgccaaggaggcgtaatggccttctgcgggac
caggtccagttggtgaaaaggaaggacacaaatcgctacgaaatcgtccgctttcctgat
ccattgtcatttgagaaaggcttctttgttatgatccgtgcctgccagcttctggtgcag
cacaatgaagggatgatttttgttggcgttgctggaccctctggggccgggaagactgtg
tttactgagaaggtgctcaatttcatgcccggtgttgctgtgatatcaatggataactac
aatgatgcaagtcgcatagttgatggcaattttgatgatccacgcctaacagactacgac
acactgttggaaaatattcatggtctgaaggagggaagatcagttcaggttccaatatat
gatttcaagatgagctgccggactggatacagaacagttgatgtccctagctctaggatt
gttatcattgaaggcatctatgcattgagtgaaaagttacgatctgtattggacctacgt
gtttctgtcactggtggtgttcattttgacctggtgaagagggtcctgagggacatacag
agagctggccaggagcctgaggaaataattcatcagatatctgaaacggtttatccgatg
tataaggctttcattgagccagacttgcagacagcacatataaaaataatcaacaagttc
aacccattctcagggttccaaaatcctatgtacattctaaagtctccacgaactataaca
cctactgacatcaaagttgctcttggtgaagatcatacagaaagcattgaagaaacttat
gatatatatttgcttcctccaggcgaagatccagaatcatgccaatcttatttgagaatg
aggaatagggaagggaaatataatctgatgtttgaggagtgggtgaccgataatcctttt
atcatatcaccaaggattacgtttgaagtcagtgttcgtcttcttggaggtttgatggca
ttgggatatactatagcagctatactgaagagaaagagtcgtgtgttttctgatggcaag
gcaactgttaaaattgattggttggagcaacttaaccgaaattatatacaggtgcaagga
agagatagaaatcatgtcaaatttgtagcggagaagttaggtctggatggctcttatatt
ccacgcacatatattgaacaaattcagctggagaaactgataaacgatgttatggcatta
ccagaagatctcaagacaaagctcagcattgatgatgagctggtttcaagtccaaaagag
gccctttctcgggtttctgctgataagagaaacaaacacctgaaaagtggtctatctcat
tcatattcaactcatggagataaaaatattgtgaaattgagtaaattgacagaaaccaac
agaaggtttggaagtgggcgagcccctgaacctcctgcaattaatcagggtgctatcact
cagctatccgaacagatttcaacgttgaatgagaggatggacgagttcacctctcgagtt
gaagaactcaactgtaaatttgcaataaagaaatcatcgaccagtcagcaaaatttagct
cttccaaatgaaacttgcaatggttctgcacctacaaatctctttgtttctcatttgggc
aatggtaccctgatacctcattcgtcatcatcgaaccaacttttgaaggagtcccccatt
gtggatgagattaatgccatatcaagaggtcagcgccaagtgatacatcagcttgacaat
ctgaccagcttgcttcatgagcatttggccttgacccgccaaggaaatgcagtccgcaga
aacgggatcctggaaatggacatgtccatctgcccactcattgccctgacaattggcggt
ttcggctatttggtgttcaagagcctcaaccggagctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4346121
Entry
4346121           CDS       T01015                                 
Name
(RefSeq) uridine kinase-like protein 1, chloroplastic
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4346121
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     4346121
SSDB
Motif
Pfam: UPRTase PRK CoaE AAA_18 Zeta_toxin T2SSE Cytidylate_kin Pribosyltran AAA_33
Other DBs
NCBI-GeneID: 4346121
NCBI-ProteinID: XP_015650860
UniProt: A0A0P0XIQ3 Q6ZIA3
LinkDB
Position
8:26389736..26395195
AA seq 491 aa
MDAAMESAVGPHFSGLRLDSRRLSSSSLPTSPSAASSNGCGGNDAPAAVNGFAPPPPPSA
AAAAEEGSKQPFVIGVSGGTASGKTTVCDMIIQQLHDHRVVLVNQDSFYRGLTEEESDRV
QDYNFDHPDAFDTEQLLECMGQLKSGLSVNIPIYDFKNHRRCSESFRKVNASDVIILEGI
LVFHDQRVRDLMDMKIFVDTDADIRLARRIRRDTVERGRDVISVLEQYGRFVKPAFDDFV
LPSKKYADVIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPNVYVVNTTFQIRGMHTLI
RDRDIATPDFVFYSDRLIRLVVEHGLGHLPFTEKQIVTPTGSTYMGVDFCKKLCGVSIIR
SGESMENALRACCKGIKIGKILIHRDGDNGQQLIYHKFPLDIAERHVLLMDPVLGTGNSA
NQAIELLISSGVPEERIMFLNLISAPEGVHCVCKRFPRLKIVTSEIETGLNEEYRVIPGL
GEYGDRYFGTD
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggacgccgcgatggagtcggcggtggggccgcacttcagcgggctccgcctcgactcg
cgccgcctctcctcctcctccctccccacctccccctccgccgcctccagcaacggctgc
ggcggcaacgacgcccccgccgcggttaacgggttcgcgccgccgccgcccccctccgcc
gccgcagccgcggaggaggggagcaagcagcccttcgtgatcggtgtgtcgggagggacg
gcgtcggggaagacgacggtctgcgacatgatcatccagcagctgcacgaccaccgcgtc
gtgctcgtcaaccaggattcattctaccgtggtttaactgaggaagaatctgaccgtgtg
caagattacaactttgatcacccagatgcatttgatacagagcaacttttagagtgcatg
ggacagcttaaaagtgggctatctgtaaatattcctatatatgattttaagaaccaccgt
cgatgctctgaaagttttagaaaggttaatgcatcagatgtcatcattttggagggcatt
ttagtttttcatgatcaaagggttcgtgatttgatggatatgaaaatttttgttgacaca
gatgccgatattagacttgcccggcgtataaggcgtgatacagttgaaagaggtagagat
gtcatctcagtgctggagcagtatgggaggtttgtgaagcctgcgttcgatgattttgtt
cttccttccaaaaaatatgctgatgtgatcataccgcgagggggagataaccatgttgcc
atagatttaattgtgcaacatattcgtacaaaacttggtcagcatgacttatgcaaaatc
tacccaaatgtttatgtggttaatacaactttccagatacgtggaatgcatactcttatt
cgcgaccgggacattgcaactccagatttcgtcttttattcagatcgtctgattcgtctg
gtagttgagcatggactggggcatttgcctttcacagagaagcagattgttacaccaaca
gggtctacttacatgggagttgacttttgtaagaagctctgtggtgtgtcaattattcga
agtggagaaagcatggagaatgcattacgtgcttgttgtaaggggattaaaataggcaaa
attctaatacatcgggatggggacaatggacaacagctcatataccacaagtttcccttg
gatattgctgaacgacatgttctactcatggatcctgtgcttggtacaggtaactcggca
aatcaagctatagaacttcttataagtagtggagttcctgaggagcggatcatgtttctc
aatctcatctcggctcctgaaggggtccattgtgtctgcaagcgattccctcgtctgaag
attgtaacctcagagatcgaaactgggttgaacgaggagtaccgggtgatcccagggtta
ggagagtatggtgatcgctacttcggtacagactaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4347509
Entry
4347509           CDS       T01015                                 
Name
(RefSeq) uridine kinase-like protein 2, chloroplastic isoform X1
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4347509
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     4347509
SSDB
Motif
Pfam: UPRTase PRK CoaE AAA_18 Zeta_toxin Pribosyltran T2SSE KAP_NTPase Cytidylate_kin AAA_33 AAA_17 Ribosomal_L30 AAA_26
Other DBs
NCBI-GeneID: 4347509
NCBI-ProteinID: XP_015611662
LinkDB
Position
9:19570001..19575611
AA seq 504 aa
MPEKAVDDVMDSAVGAHFSGLRLEALRLSSPSAPSSPSSAKAAAAAAAHSNGAVYANGVA
ADAAELVSPSALRQPFVIGVSGGTASGKTTVCDMIIQQLHDHRVVLVNQDSFYRGLTAEE
SAHAQDYNFDHPDAFDTEQLLECMGQLKRAQPVNVPIYDFKNHRRSSESFRKVNASDVII
LEGILVFHDQRVRNLMDMKIFVDTDADIRLARRIRRDTVERGRDVSSVLEQYGRFVKPAF
DDFVLPSKKYADVIIPRGGDNHVAIDLIVQHIRTKLGQHDLCKIYPHVYVVQTTFQIRGM
HTLIRDRDITTPDFVFYSDRLIRLVVEHGLGHLPFTEKQIITPTGSIYMGVEFCKKLCGV
SIVRSGESMENALRACCKGIKIGKILIHRVGDNGQQLLFTLPLQLIYHKLPMDIAERHVL
LLDPVLGTGNSANQAIELLIRKGVPEERIIFLNLISAPEGIQCVCKRFPRLKIVTSEIDT
GLSEEYRVIPGLGEYGDRYFGTDN
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgccggagaaggcggtggacgacgtcatggactcggcggtgggggcgcacttcagcgga
ctccgcctcgaggcgctccgcctctcctccccctccgccccgtcctccccttcctccgcc
aaggcggccgcggcggcggccgcccactccaacggcgccgtctacgccaacggcgtcgcc
gccgacgccgcggagcttgtgtcgccatccgcgctcaggcagcccttcgtcatcggggtt
tcgggtgggacggcgtcggggaagacgacggtgtgcgacatgatcatccagcagctgcac
gaccaccgtgtcgtgctcgtcaaccaggattccttctaccgtgggttaactgctgaagaa
tctgcacatgcccaagattacaactttgatcaccctgatgcatttgacacagagcagctt
ctggaatgcatggggcagctaaaacgggcacagcctgtaaatgttcctatatatgatttt
aagaatcaccgacggtcctctgaaagctttagaaaggtcaatgcatcagatgtcattata
ttagagggcattttagtcttccatgatcaaagagttcgcaatctgatggacatgaaaatt
tttgtggacacagatgctgatattaggctagctcgacgaataaggcgtgatacagttgaa
agaggtagagatgttagctcggtgcttgagcagtatggcaggtttgtgaagccagcattt
gatgattttgttctcccttcgaaaaaatatgccgacgtgatcataccacgaggaggtgat
aatcatgtggcaattgacctgattgttcaacatattcgtactaagcttggtcagcatgac
ttgtgcaaaatctatccacatgtttatgtggttcaaacaacattccagatccgaggaatg
catactctgattcgtgacagggacatcactacacctgactttgtcttttattcagatcgg
ttgatccgtttggtagttgagcacggactggggcatttgccatttacagaaaagcagatt
attactccaacagggtccatttatatgggagttgaattttgcaagaagctctgtggagtg
tctattgtccgaagtggtgaaagtatggagaatgcattgcgtgcttgttgtaaaggaata
aaaattggcaagattctaatacatcgtgttggagacaatggacagcaattattattcact
ttgccattgcagcttatataccataaactgcccatggatattgctgaacggcatgttctt
cttttggatccagtgcttggtacaggtaactcagcaaatcaagctattgagcttctgata
agaaaaggtgttccagaggagcgaatcatatttctcaatcttatctcggctcctgaggga
attcagtgcgtctgcaagcgatttccgaggctgaagattgtaacctccgagatcgacacc
gggttgagcgaggaatacagggtaatcccagggttgggagagtacggtgaccgctacttc
ggcacagataattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350243
Entry
4350243           CDS       T01015                                 
Name
(RefSeq) uridine kinase-like protein 3
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4350243
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine/cytidine kinase
     4350243
SSDB
Motif
Pfam: UPRTase PRK Pribosyltran AAA_18 CoaE Cytidylate_kin Zeta_toxin KAP_NTPase T2SSE
Other DBs
NCBI-GeneID: 4350243
NCBI-ProteinID: XP_015615299
UniProt: A0A0P0Y183 Q53LT4
LinkDB
Position
11:9034228..9042583
AA seq 491 aa
MGSTSRPVDDEVLDAATGVHYSALRLEELNMNGSVSGEDQPTTSGVENGHQEPFVIGVAG
GASSGKSTVCKMIIDQLRDQRVVVVTQESFYYGLSDEELVHVHDYNFDHPDAFDTELLLS
CMENLKHGKAVDIPNYNFKTYKSVASARKVNPSDVIILEGILVFHDSRVRDLMNMKIFVD
TDADVRLTRRIRRDTIEKGRDIKTVLDQYSKFVKPAFEDFILPTKKYADIIIPRGGDNDV
AIDLIVQHIRTKLGQHDLCKVHPNLYVIQTTYQIRGMHTIIRDAATTTHDFIFYADRLIR
LVVEHGLGHLPFKEKQVITPTGSVYTGVEFSKRLCGISVIRSGESMENALRACCKGIKIG
KILIHREGDNGKQLIYHNVPKDIANRHVLLLDPILGTGNSAVQAISLLLKKGVQETNIIF
LNLISAPQGVHVVSKRFPRVKIVTSEIDFGLNDDFRVIPGMGEFGDRYFGTDDYQSSTPF
FCDEKNRVRLL
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgggttcaacttcaaggccagttgatgatgaagttcttgatgccgccaccggggtacac
tactctgcgctccgtttggaagagcttaacatgaatggctccgtgtcaggggaggaccaa
ccgacaacctcgggcgtggagaatgggcaccaggagccatttgtcattggtgtcgctggg
ggtgcatcttcaggtaaaagtactgtatgcaagatgataattgatcagctacgtgatcag
cgtgtggttgttgttactcaggagtccttttattatgggttatctgatgaggaattggtc
catgttcatgattataactttgatcatccagatgcatttgatacggagttactactctct
tgtatggagaacttgaaacatggcaaggctgtggacattcctaattataacttcaaaaca
tataagagtgtagcaagcgcaagaaaggtcaatccttcagatgtaattattttggaaggt
attctggttttccatgattcacgtgtccgggacttgatgaacatgaagatatttgttgat
acagatgctgatgtgcgattaacaaggaggattcgacgtgacaccattgagaagggtaga
gatatcaaaactgtgctagatcagtattcaaagtttgttaagcctgcttttgaagacttc
atcctcccaaccaagaagtatgctgatattatcatcccacgaggtggagataatgatgtt
gcgattgacttaatcgttcagcatattcgcactaagcttggtcaacatgatctctgtaaa
gtacaccccaatttgtatgtcattcagactacttatcagatacgaggtatgcacacaata
atacgcgatgctgccacaacaacacatgatttcatattctatgccgatcggttgattcga
ttggttgtcgagcatggtcttggtcatcttccattcaaggaaaaacaggtcataactcca
actggttctgtttacactggggtagagttctctaaaagattgtgcggtatctcagtgatt
agaagtggtgagagtatggagaatgcattgcgggcatgctgtaaaggtataaaaattggg
aagattcttattcacagagaaggagacaatggcaaacagctaatctatcacaatgtacca
aaagatatagcaaacaggcatgttctattgttggatcccatactgggaacaggaaattca
gctgttcaagctatatccctactcttgaagaagggtgtacaggaaacaaacattatcttt
ctgaatcttatatcagctccccaaggagtgcatgtcgttagcaagagatttccgagagtc
aagatcgtgacatcagaaattgactttggtctgaacgatgatttccgcgtcatccctgga
atgggtgagtttggagataggtacttcggaacagatgattatcagtcatcaacaccattc
ttttgcgacgagaaaaatcgtgtcaggcttttgtga

DBGET integrated database retrieval system