KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329034
Entry
4329034           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L27-3
  KO
K02901  large subunit ribosomal protein L27e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4329034
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4329034
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4329034
SSDB
Motif
Pfam: Ribosomal_L27e KOW
Other DBs
NCBI-GeneID: 4329034
NCBI-ProteinID: XP_015627615
UniProt: A3A5L7 Q6K4T1
LinkDB
Position
2:complement(10700784..10701529)
AA seq 137 aa
MVKFLKPGKAVILLQGRYAGRKAVIVRVFEEGTRDRPYGHCLVAGLAKYPKKVIRKDSAK
KTAKKSRVKCFLKLVNFTHIMPTRYTLDVDFKDVASGGPDALATRDKKVAACKAAKARLE
ERFKTGKNRWFFTKLRF
NT seq 414 nt   +upstreamnt  +downstreamnt
atggtgaagttcctgaagccggggaaggcggtgatcctgctgcaggggcggtacgcgggg
cggaaggcggtgatcgtgcgcgtgttcgaggagggcacccgtgaccgcccctacggccac
tgcctcgtcgccggcctcgccaagtacccgaagaaggtgatccgcaaggactcggcgaag
aagacggcgaagaagtcgagggtcaagtgcttcctcaagctcgtcaacttcacccacatc
atgcccacccgctacaccctcgacgtcgacttcaaggacgtggcctccgggggacccgac
gccctcgccacccgcgacaagaaggtggccgcctgcaaggccgccaaggctcgcctcgag
gagaggttcaagaccggcaagaacaggtggttcttcaccaagctccgcttctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349409
Entry
4349409           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L27-3
  KO
K02901  large subunit ribosomal protein L27e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4349409
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4349409
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4349409
SSDB
Motif
Pfam: Ribosomal_L27e KOW
Other DBs
NCBI-GeneID: 4349409
NCBI-ProteinID: XP_015612809
UniProt: Q7XC31 A3C7D8
LinkDB
Position
10:complement(22288662..22289398)
AA seq 136 aa
MVKFLKPGKAVILLQGRFAGRKAVIVRVFEEGTRDRPYGHCLVAGLAKYPKKVIRKDSAK
KTAKKSRVKCFLKLVNFTHLMPTRYTLDVDLKEVAAGPDALATRDKKVAACKSAKARLED
RFKTGKNRWFFTKLRF
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtgaagtttctcaagcccgggaaggcggtgatcctgctgcaggggaggttcgcgggg
cggaaggcggtgatcgtgcgggtgttcgaggagggcacccgcgaccgcccctacggccac
tgcctcgtcgccggcctcgccaagtaccccaagaaggtgatccgcaaggactcggcgaag
aagacggcgaagaagtcgcgcgtcaagtgcttcctcaagctcgtcaacttcacccacctc
atgcccacccgctacaccctcgacgtcgacctcaaggaggtcgccgcggggcccgacgcg
ctcgccaccagggacaagaaggtcgccgcctgcaagtccgccaaggcgcgcctcgaggac
cgcttcaagaccggcaagaacaggtggttcttcaccaagctccgcttctga

DBGET integrated database retrieval system