KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329095
Entry
4329095           CDS       T01015                                 
Name
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4329095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4329095
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4329095
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4329095
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 AAA DUF2075 Sigma54_activ_2 Flavi_DEAD T2SSE TsaE AAA_16 PhoH ABC_tran
Other DBs
NCBI-GeneID: 4329095
NCBI-ProteinID: XP_015626249
UniProt: Q6K4U8
LinkDB
Position
2:11668252..11673606
AA seq 1240 aa
MAPTAAAAGPSDDGLRKLEYLSLVSKVCSELETHIGVGDKVLAEFITELGRDSASVADFD
TKLKANGADLPDYFVRTLLTIIHAILPPPSDSRNPSSASQPAAGGSKFPGLSRPDDPDRA
RNLRLELERDAEEAAATAAPAPARDDRGRRRDERGRDRGRDDRGRDDGGRDRDYERGGRD
HDRSHGRDRDHGRDRDRDRACDGDRQRGRDYGRDRDQDRDHDRDREGERRRDRDKDRGRD
IDRDMDRDHRRGRRYDDEEEPEQFGGRKEGALVNSSGEPELYQVYRGRVTRVMDTGCFVR
LEDVRGGREGLVHISQMATRRVANAKEMVKRDQEVYVKVVSVKGQKLSLSMRDVDQDTGR
DLLPIQRGGDDAPRANPSGGSASGVGVGSGKRLGLSGIMIAEEDEVAPPSRRPLKRMSSP
ERWEAKQLIASGVLDVRDYPMFDEDGDGMLYQEEGAEEEQEIELNEDEPAFLQGQSRFSI
DMSPVKIFKNPEGSLSRAAALQTALIKERREVREQEQRAMLDSIPKDLNRPWEDPMPDTG
ERHLAQELRGVGLSAYDMPEWKKEAYGKALTFGQRSKLSIQDQRQSLPIYKLKKELIQAV
HDNQVLVVIGETGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRL
GEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILVDENLSQYSVIMLDEAHERTIHTDVLF
GLLKQLIKRRSDMRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLD
AALITVLQIHLTEPEGDILLFLTGQEEIDHACQCLYERMKGLGKDVPELIILPVYSALPS
EMQSKIFDPAPPGKRKVVVATNIAEASLTIDGIYYVVDPGFAKINVYNSKQGLDSLVITP
ISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMSPTTIPEIQRINLGSTVLNMKAMGIN
DLLSFDFMDPPAPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVD
LGCSDEILTIIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFS
GPWCFENFVQSRSLRRAQDVRKQLLTIMDRYKLDVVSAGRNFTKIRKAITAGFFFHAARK
DPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLTELAP
RFYKSADPTKMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3723 nt   +upstreamnt  +downstreamnt
atggcgccgacggcggcggcggcggggcccagcgacgacgggctccggaagctggagtac
ctctcgctggtctccaaggtgtgctcggagctggagacccacattggcgtcggcgacaag
gtgctcgccgagttcatcaccgagctcggccgcgactccgcctccgtcgccgacttcgac
accaagctcaaggccaacggcgccgacctcccggactacttcgtccgcaccctcctcacc
atcatccacgccatcctcccgccgccctccgactcccgcaaccctagctccgcgtcgcag
cccgccgcggggggctccaagttccccggcctctcccgccccgacgaccccgaccgcgcc
cgcaacctccgcctcgagctcgagcgggacgccgaagaggccgccgcgacggcagccccc
gcccccgccagggacgaccgcggccgccgccgtgatgagcgaggacgggaccggggtcga
gatgaccgcggccgcgacgacggtgggcgtgaccgcgactatgaacgcggcggccgtgac
catgaccgcagccatggccgggatcgtgaccatggccgtgacagagaccgagatcgagcc
tgtgatggggatcgacaacgtggccgtgactatggccgtgatagagaccaagacagagat
cacgacagggatcgtgaaggtgaacggcggagggaccgagataaggataggggtagagac
attgacagagatatggacagggaccataggcgaggcaggaggtatgatgatgaggaagaa
ccagaacagtttggtggaaggaaagaaggcgctcttgtgaattccagtggcgagccagag
ttgtaccaggtgtaccggggtagggtgacacgggtaatggacaccggttgctttgtcagg
cttgaggatgttcgtggaggacgtgagggtcttgttcacatctcacaaatggcaaccagg
cgagtggccaatgcgaaagagatggtgaagcgtgatcaggaggtgtatgttaaggtggtt
tccgtgaagggccagaaattgagtttatcaatgagggacgtagatcaggatacagggaga
gatctcctgccaatacaacgtggtggggatgatgcaccaagggcgaacccatctggtggt
agtgctagtggtgttggtgtgggctctggcaagaggctgggtctctctgggattatgatt
gcagaggaggatgaggttgcacctccttcacgtcggccacttaagcggatgagctctcca
gagaggtgggaggcgaagcagctgattgcttcaggtgttctggatgtgagggattaccca
atgtttgatgaggatggggatggtatgttgtaccaggaggaaggggcagaagaggagcag
gagattgagcttaatgaagatgaacctgctttcttgcagggacagagtagattttcgatt
gacatgtcacctgttaagattttcaagaatccagagggctcattgagccgagcagctgct
ctccaaactgctctcataaaggagcggcgtgaggttcgggaacaggaacagagagcaatg
ttggattcaatccccaaggatctgaatcggccatgggaggaccctatgcctgatactggg
gaacggcaccttgcgcaggagctgaggggtgttggactttcagcttatgacatgcctgaa
tggaagaaagaagcctatggaaaggctctgacatttgggcaaaggtctaagctttcaata
caagaccagaggcaaagtcttccaatatacaagttgaagaaagagctgatacaagctgtg
catgataaccaagtcttggttgttattggagagactggttctggtaaaacaacacaggtg
acacaatatttggccgaagcaggctacacgaccagaggtaagattggttgcactcaacct
cgtcgtgtggctgcaatgtctgttgctaagagagtagcagaagaatttggttgtcgactt
ggagaggaagttggttatgccatccgctttgaggattgcactgggcctgacacggtaatc
aaatacatgactgatggcatgcttttgcgtgagattcttgtcgatgagaacctttcccag
tattctgtaattatgcttgatgaagcgcatgaaaggaccatacacacagatgttctcttt
ggcttgctgaaacagcttattaagcgcagatctgacatgaggcttattgttacttctgct
accctggacgcagagaagttctcagggtattttttcaattgcaacatcttcacaattcct
ggaaggacgttcccggtagagatactctacaccaaacaaccagaaagtgactatttggat
gcagcattgatcaccgtgcttcaaatacacttgactgagccagaaggtgatatcctcctt
tttttgactggtcaagaggagattgatcatgcttgtcaatgtctttatgagaggatgaaa
gggctagggaaggatgttcctgagctcataatattgcctgtttatagtgctcttccgagt
gaaatgcagtcgaagatctttgacccagctcctccagggaagaggaaggttgttgtggcc
accaatatcgctgaagcttctctaaccattgacggcatatattatgtcgtcgatcctggt
tttgccaaaattaatgtttataattcaaaacaaggactcgattcattggtcatcactcca
atctctcaagcatcagcgaagcagagggcagggcgtgctgggcgtactggccctggcaaa
tgctatcgtctatacactgaaagtgcataccgcaatgaaatgtctcccacaacaatccca
gaaattcaaaggattaacttggggtctacagttctcaacatgaaggcgatgggaatcaat
gacctattatcctttgatttcatggaccctcctgcacctcaagcacttatatctgcaatg
gagcaattgtacagcctaggtgctcttgatgaagaagggctccttaccaaactggggagg
aaaatggctgaatttccactggatccaccactttcgaagatgcttctagccagcgttgac
cttggatgcagtgatgagatactaactattatagctatgatacaaactgggaacattttc
tataggccaagagaaaaacaggctcaggctgatcaaaagagggccaagtttttccagcca
gagggggatcatctaactctgcttgctgtatatgaggcgtggaaggcaaaaaacttttca
gggccctggtgttttgagaactttgttcaatcaagatccttaaggagagctcaagatgtg
aggaagcagcttctcactatcatggacagatataaattggatgttgtctcagctgggagg
aacttcacaaaaataaggaaagcaatcactgccggcttctttttccacgctgccaggaag
gatccccaggagggatacagaaccttggtagagaaccagccggtgtacatacacccgagc
agcgcattgttccagcggcagccagactgggtcatctaccacgaacttgtaatgacgacg
aaggagtacatgcgggaggttaccgtgatcgacccgaagtggcttactgagctagccccg
agattctacaagtcagcagacccaaccaagatgagcaagaggaagaggcaggagaggatt
gaacccctgtacgacaggtaccatgagcccaactcctggcgtctcagcaagcgccgagct
tga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340375
Entry
4340375           CDS       T01015                                 
Name
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4340375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4340375
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4340375
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4340375
SSDB
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_19 AAA_30 DUF2075 T2SSE FtsK_SpoIIIE DAP3 AAA_25 CAP PhoH ABC_tran
Other DBs
NCBI-GeneID: 4340375
NCBI-ProteinID: XP_015641161
UniProt: Q69TI7
LinkDB
Position
6:4659849..4667023
AA seq 698 aa
MPSFPSSGASPQKQQHNARRRQLIRQQRKSLPIASVEKRLIEEVRKNDTLIVVGETGSGK
TTQLPQFLYDAGFCQDGKVIGITQPRRVAAVTVAKRVAEECNDQLGKKVGYSIRFDDSTS
NATRIKYMTDGLLLREALLDPLLSKYSVIVVDEAHERTVHTDVLLGLLKKVQHSRSIYAN
KNGKILPDIQHQSQYFTLKACQGTKIDPLKLIIMSASLDAKCFSDYFGSAKAVHIQGRQY
PVDILYTYQPESDYLDATLVTIFQIHLEEGPGDILAFLTGQEEIESLDRLIQERARQLPP
QRSKIWTTPIYSSLPSEQQMNAFKPAPAGTRKVVLATNIAETSVTIPGIKYVIDPGMVKA
RAYNPVTGMESLIIIPVSKAQALQRSGRAGREGPGKCYRLFQESEFDKLVDSTVPEIKRC
NLANVVLQLKALGIDDIIGFDFMEKPSRTAILKSLEQLILLGALTDDYKLSDPVGRQMAR
LPLDPMYSKALIVASEFKCLEEMLIVVSMLSVESIFFSPREKLEEARAARKSFESSEGDH
ITLVNVYRAAKECLEKSKNANAKEKTMEKALNRWCRENFINYRSLRHACDVHSQIQGHVQ
QMGLNVSSCGDDMVLFRRCLTAAFFLNAAMRQPDGSYRALATSQSVQIHPSSVLFQKKPD
CAIFNELVRTSQNYVKDLTRIDPVWLAELAPQYYATED
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgccgtcgttcccttcctccggcgcttctccgcagaagcagcagcacaacgccaggagg
aggcagctgattcggcagcagaggaagtcgctccccatcgcctcagtggagaagaggctt
attgaagaggtgaggaagaatgacacgttgatcgttgtcggcgagaccggaagtggcaag
acaactcagttgccacaatttttgtatgatgctgggttttgtcaggatggaaaagtcatt
ggcataactcagcctcgaagagttgcagctgttactgtagcaaagcgtgttgctgaggaa
tgcaatgatcagttgggcaaaaaggttggctattctattagatttgatgattcgacatca
aatgcaacgaggattaagtacatgactgatggtttgcttttaagggaggcacttctggat
ccacttttgtctaagtatagtgtcatagttgttgatgaggcacacgaaagaactgtacat
actgatgtcttgttgggtttgctgaaaaaagtgcaacattcccgatccatttatgccaat
aagaatggaaagattttgcctgacatacaacatcagtctcaatattttactctgaaggca
tgccaaggaacaaaaattgatcctctaaaactgataattatgtctgctagtttggatgca
aagtgtttttcagattattttggcagcgctaaagctgtacatattcaaggacggcaatac
cctgttgacatactatacacttatcagcctgagtcagattatctggacgctacactagtt
actatctttcagatccatttggaggaaggaccgggggacattcttgcatttcttactggc
caagaggagattgagtcactggacagacttattcaggagcgtgctcgtcaacttccacca
cagagaagtaagatatggactacacctatttactcatctcttccatcagagcagcaaatg
aatgcttttaagcctgcaccagctggaactcgcaaggtggttttagcaacaaatattgca
gagacttctgtaacaatacctggtatcaaatatgttattgatcctgggatggtcaaagct
cgtgcttataatcctgtaactggaatggaatctctgatcattatccctgtttcgaaagca
caggctcttcagaggagtggccgtgccggacgagagggaccagggaagtgctaccgattg
ttccaagaaagtgagtttgataagctggtggattctactgtgcctgagatcaagcgatgt
aaccttgcaaatgttgtactacagctcaaagctcttggaattgatgacatcataggtttt
gattttatggagaaaccatcaaggacagctattttgaaatcattggagcagttaatttta
ttaggtgctctgactgatgattataagttgtcagatccagttggtcgtcagatggctagg
ctacctttggatccaatgtactccaaggcactaatagtagcaagcgaattcaagtgcttg
gaagagatgttgattgttgtctctatgctttcagtggaatctattttcttcagcccacgt
gagaagttagaagaggcaagagctgctaggaagagttttgaaagctctgaaggggaccac
ataaccttggtgaatgtatatcgagccgctaaagaatgcttggagaaaagcaaaaatgca
aatgccaaagagaaaacaatggaaaaggcattgaacagatggtgcagggaaaatttcatc
aattaccggtctctaagacatgcttgtgatgttcacagccaaattcagggccatgtccaa
caaatggggcttaacgtatcatcgtgtggggatgacatggttctgttccggagatgcctc
acagctgctttcttcttgaatgccgcaatgcgacagccagatggatcatacagggctctt
gcaaccagccagagcgtgcagatccatccgtcatcggtgctcttccaaaagaagccagat
tgtgccatcttcaacgagttggttcgaacgagtcagaattacgtcaaggacctgacccgg
atcgatcccgtgtggctggctgaacttgccccgcaatattacgccactgaggattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4343939
Entry
4343939           CDS       T01015                                 
Name
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4343939
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4343939
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4343939
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4343939
SSDB
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 RRM_1 DEAD zf-RING_UBOX AAA_22 zf-C3HC4_2 AAA_30 ABC_tran AAA_19 NACHT gp37_C AAA_29 Arc_MA
Other DBs
NCBI-GeneID: 4343939
NCBI-ProteinID: XP_015646613
LinkDB
Position
7:complement(25679892..25689960)
AA seq 1732 aa
MRRSNDGRPFRPPDWGPPPHRYHHHHQNQYQYQQRYRPAQPGPRQFAVILLRGGSNLSAP
PATEVEALVAGLPSPPPDSLSVSSSGRQAARLAFRSPQAAAAAARELWSLRLEGLHLLTP
DVSDPALAAHAAPLIASLFAAHAARLVDSDLVSLTAARSSELAASIQAVKRRLAGHNRIR
DFEQLQAQKRTLKAEKELVDAKIDEYKAAMRSIRRALLRGTEDDEEAEEEGLEVFGIGGG
GEMNFARLHMIMLRECRRLKEGLPIYAYRRNILDHIFANQVMILIGETGSGKSTQLVQYL
ADSGLAANGSIVCTQPRKIAAISLAHRVVEESNGCYGDNFVLNSTFLDHQDFSSKIIYTT
DNCLLHHCMNDMGLDGISYIIVDEAHERSLNTDLLLALIKKKLLDRLDLRLIIMSATADA
NRLAEYFYGCQTFYVKGRSFPVEIKYVPDISEEASFNTVPNHLRGSCATASYVYDVVKMV
SIIHKNEEEGAILAFLTSQLEVEWACENFSDADAVVLPMHGKLSHVEQSLVFKSYPGKRK
IIFCTNIAETSLTIKEVKYVVDSGLAKESRFVPSSGLNVLKVNWISQSSANQRAGRAGRT
GAGRCYRLYSESDFSMMEVHQEPEIRKVHLGTAVLRILALGIRDAQNFEFVDAPNPEAIN
MAVKNLEQLGAVKYKCDGFELTDTGRYLVKLGIEPRLGKIMLDCFGFGLRKEGVVLAAVM
ANSSSIFCRVGTDEEKYKADRLKVPFCHQDGDLFTLLAVYKEWEDEHENRNTWCWQNSIN
AKTMRRCQETISDLENCLRHELNIIVPSYWCWNPEESTVHDKLLKRIILTSLSGNIAMFS
GHERFGYQVISTDQAVKLHPSCSLLIYDSKPEWVVFTEILSVPNQYLVCVTAIDPDALCS
IHPMPLIQQLEKLKLQVKVISGLGYNLLRKFCGKSGQNQQKIISLLQEEFRDDRVTVEVD
FRNKEVVLFAKEQDIEKVFGIVNDALECEARMLRNECLEKSLFSGKPGDCSLALFGSGAE
IKHLELEKRYLTVEVLHQNAHELNDKELICLVDTLISGVANFYKLYGNLQVASDETKWGK
FTFLNPEYAEDAVSKLNGMEFHGSPLKVVPVCSSSNRGLPFPAVRAKVSWPLKQSRGLAL
VTCASGEAEFVVKDCFALGVGGRYINCEVSTRHENCIFVRGIPMHVTEPELYDAFRSTTT
RKIVDVHLLRGTPIAAPSASLCAEALNREISSFMPKKIFPAQNFRVEVLTPEENDSVMRA
TITFDGSLHREAARALEHLQGSVLPCCLPWQTIQCQHVFHSTVSCQVRVYNVISQAVASL
LESFRSQKGVSYNLEKNEYGIFRVKLTANATKTIADLRRPLEILMKGKTINHPDLTLSTV
QLLMSRDGVADLKSVEQETGTYILYDRQSLNIKVFGLQDQVAAAEEKLIHALLQLRDKKP
LDIRLRGRNLPPNLMKEMLKKFGADLEGLKREVPAVELRLNLRQHTLYVRGSKEDKQRVE
EMISELVNSTKYNGLLQLPLENACPICLCEVEDPFKLESCGHVFCLTCLVDQCESALKSH
DGFPLCCLKNGCKKQLLVVDLRSLLSSEKLEELFRASLRAFVASNAGKYRFCPTPDCPSI
YQVAAADAESKPFVCGACFVEICNKCHLEYHPFISCEAYKEYKEDPDATLLEWRKGKENV
KVCPSCHFTIEKADGCNHVECKCGSHICWACLENFRSSDDCYSHLRSVHLSY
NT seq 5199 nt   +upstreamnt  +downstreamnt
atgcgccgatccaacgatggccgccccttccgcccgccggactggggcccgccgccgcac
cgctaccaccaccaccaccagaaccagtaccagtaccagcagcggtatcgccccgcgcag
ccggggccgcggcagttcgccgtgatcctcctccgcggggggagcaacctctcggcgccg
ccggccacggaggtcgaggcactcgtcgccggcctgccctcccctcccccggacagcctg
agcgtctcctcgtcgggccgccaggccgcgcgcctcgcgttccgctccccgcaggccgcc
gccgccgccgcgcgcgagctctggtcgctccgcctcgagggcctccacctcctcaccccg
gacgtctccgatcccgccctcgccgcgcacgccgcccccctcatcgcctccctcttcgcc
gcccacgccgcccgcctcgtcgactccgacctcgtctccctcacggccgcccgctcctcc
gagctcgcggcctccatccaggcggtgaagcgccgcctggcggggcacaatcgcatccgc
gacttcgagcagctccaggcccagaagagaactctcaaggctgagaaggagttggtagat
gctaaaatcgatgagtacaaagccgcgatgagatcgatacggcgtgcattgttgcgtggg
acggaggatgacgaggaggcagaggaggaagggttggaggtgtttgggattgggggaggt
ggtgagatgaatttcgctaggctgcacatgataatgctgcgggaatgtagaaggcttaag
gaggggctacccatctatgcttaccgcaggaacattctagatcacattttcgctaaccag
gtgatgattttgattggggaaactggttctgggaagagcacacaattggttcagtatctt
gctgactcaggtcttgctgctaatggttcaattgtctgtactcaaccccgaaaaattgct
gctatatcattggcacatagagtagttgaagaaagcaatggttgctacggggacaacttt
gtgttgaattcaacctttttagatcatcaagatttcagttcaaagattatatataccaca
gacaactgccttttgcatcactgtatgaatgatatgggactagatggcatttcatatatt
attgttgatgaagcgcatgaacgaagcttgaacaccgatcttctcttagctttgattaag
aagaaactgcttgataggctggatttgagacttatcataatgtctgctactgccgatgct
aatagactcgctgaatatttttatggatgccaaacattttatgttaaagggcgaagtttt
cctgttgaaattaaatatgtccctgatatatcagaagaggcttccttcaataccgtgcca
aaccatctgcgcggttcttgtgctactgcttcatatgtttacgatgttgtgaaaatggta
agcatcattcacaagaatgaagaagagggtgctatccttgctttcttgacttctcaactc
gaagttgaatgggcatgtgaaaacttcagcgatgcagatgctgtggtacttccgatgcat
ggaaagctttcccatgtagagcaaagtctagttttcaagagctatcctgggaagagaaaa
ataatcttctgcacaaatattgctgaaacatcattgaccataaaagaagtgaagtatgtt
gttgattctggactggctaaggagagcagatttgtgcctagcagtggtctcaatgtactg
aaagttaattggatctcccaaagttctgctaatcagcgtgctggccgagcaggtcgaact
ggagcggggaggtgttacaggctttactctgaatctgacttcagtatgatggaagtgcat
caagaacctgaaatccgcaaagttcatcttggcactgctgttctgagaatacttgcgctg
ggtattagggatgcacagaattttgaatttgttgatgccccaaacccagaagctattaat
atggctgtaaagaatcttgaacaactgggtgctgtaaaatataaatgtgatggttttgag
ctgactgatactggtcgctacctagttaaattgggaatcgagccgaggcttgggaaaatc
atgcttgattgctttggttttggtttgaggaaggaaggtgtagttctagctgctgttatg
gcaaattctagcagcatattttgtagagtgggcacagatgaggagaaatacaaagctgac
cgtctaaaggtcccattctgtcatcaggatggagatctgttcactttactagctgtatat
aaagagtgggaggatgagcatgaaaacaggaatacgtggtgctggcagaatagcatcaat
gccaagaccatgaggaggtgccaggaaacaatatcagaccttgagaattgtttaagacac
gagctgaacatcattgtcccaagttactggtgttggaaccctgaggagtccaccgtgcat
gataagttgctaaaaagaattattctcacatctctttctggtaatattgctatgttttct
ggacatgaaaggtttggttaccaggtgatttcaacggatcaggctgtgaaactacatccc
tcttgctcattgctcatttatgatagcaagcctgagtgggtggtgttcacagaaatcttg
tcagtaccaaatcaatatttggtatgtgtaactgctattgatcctgatgctttgtgttcg
attcaccccatgcctttgattcagcaactggagaagcttaaattgcaggtgaaggtaata
agtggacttggatataacttgctgagaaaattttgtggaaaatctggccaaaatcagcag
aagataatctcacttctccaagaagaattcagggatgaccgtgtgactgttgaagttgac
ttcagaaataaagaggttgtgctatttgccaaagaacaagacatagaaaaggtgtttggc
atcgttaatgatgcattggagtgtgaagctcggatgttgaggaatgaatgccttgagaaa
agtttgttttctggaaaacctggtgattgttctcttgccctatttggttctggtgctgaa
ataaagcatttggaacttgagaagaggtatctgaccgtagaggttttgcatcaaaatgct
catgagttgaatgacaaggagcttatttgcttggtggatactcttatctctggtgttgct
aatttttataaactttatggaaatcttcaggtggcctcagatgaaacgaagtgggggaag
tttacattcctcaatcctgaatatgctgaagatgctgtttcaaaattgaatgggatggaa
tttcatggttctccattgaaagtggttccagtatgctcttccagtaatcgaggattacca
tttccagcagtgagagctaaagtatcttggccacttaagcaaagtcggggactcgcgctg
gtaacatgtgccagtggggaagctgaatttgttgtaaaggactgctttgctctgggagtt
ggtggaaggtatatcaactgtgaggttagtacaagacatgagaattgcatttttgtcaga
ggaattccaatgcatgtaacagagccagaattgtatgatgcctttcgtagcacgacaaca
aggaaaatcgttgatgtgcatttgctcaggggaacacccatagctgccccttctgcttcc
ttgtgtgcagaagcactaaatagagaaatttcttccttcatgccaaagaaaatttttcct
gcccaaaatttccgtgttgaggtgttaactccagaggagaatgattcggtgatgagagcc
actattacttttgatggaagtcttcatcgagaggctgcaagagcattggaacatcttcaa
ggaagtgttcttccatgctgtcttccttggcagacaatacaatgccagcatgtgtttcat
agtactgtgtcctgtcaagtacgcgtgtataatgttatcagccaagcagttgcttctctt
cttgagagcttccgaagccaaaaaggcgtgtcttacaatttggaaaagaatgaatatggt
atattccgtgtcaagcttactgcaaacgccacaaaaacaatagcagacttgagaaggcct
cttgagattttaatgaaaggcaaaacaataaaccatcctgatctgacactaagtacagtt
cagttgctcatgtcccgtgatggtgtagcagatttgaaatctgttgagcaagagactggc
acttacattctgtatgacagacaaagtctaaatattaaagtctttggactccaagatcag
gttgctgcagcagaggagaaattgatccatgcccttctacaactccgtgataagaaacct
ttggatattcgtcttcgtggccgtaacctacctccaaacttgatgaaggaaatgttaaaa
aagttcggggctgatctggaaggattgaagagagaggtgcctgcagtagagcttcgatta
aatttacgacaacatacactttacgttcgaggcagtaaagaagacaagcaaagggtggaa
gaaatgatctctgagctggtaaattctacaaagtacaatggcctgcttcaacttccatta
gagaatgcatgccctatttgcctgtgtgaggtagaagatccctttaagcttgaatcttgt
gggcatgtgttttgtctgacttgcttggtggatcagtgtgaatctgctttgaaatcacat
gatggtttccctctgtgttgcctcaaaaatgggtgcaagaagcagctccttgttgttgat
ttgagatctctcctatcgagcgagaaactggaagagctatttagagcctccttgagagca
tttgttgcttctaatgcaggaaaatatcgtttctgtcctactcctgattgcccatccatt
taccaagtggctgctgcagatgctgaaagcaaaccttttgtctgtggggcttgctttgtg
gagatctgcaacaagtgtcatcttgaatatcatcctttcatatcctgtgaggcatacaaa
gaatacaaggaagaccctgatgcaactctgcttgaatggcgcaaggggaaggagaatgtg
aaggtatgcccttcttgccactttacaatcgagaaagctgatggttgcaaccatgtcgag
tgtaaatgtggcagtcacatttgttgggcatgcttggagaacttcaggagcagtgatgat
tgttatagccatctcaggtctgtgcacctatcctattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4350353
Entry
4350353           CDS       T01015                                 
Name
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4350353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    4350353
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     4350353
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    4350353
SSDB
Motif
Pfam: HA2 Helicase_C OB_NTP_bind DEAD AAA_22 AAA_30 DUF2075 AAA_19 cobW ABC_tran AAA_16 Helicase_RecD ATPase_2 AAA_33 AAA_14 Flavi_DEAD AAA_29 T2SSE AAA_24 PhoH
Other DBs
NCBI-GeneID: 4350353
NCBI-ProteinID: XP_015617830
UniProt: A0A8J8YFW5 Q2R6C2
LinkDB
Position
11:11908766..11924809
AA seq 708 aa
MPSPPPPPQPSPPELPISEHEDEIMAAVEANPVVVVIGETGSGKSTQLSQILHRRGYTRR
GAIAVTQPRRVAAVSVSRRVAQELSVPLGDEVGYAIRFEDRTSEKTCIKYLTDGVLLRES
LSDPELKQYSVIILDEAHERSLNTDILLGLMKRLIKDRASDLKVLITSATLDGLKVSKFF
SGCPVLNIPGTLFPVEKFYSTEHPTNYIESSLRTAIDIHVKESPGDVLIFMTGKDDIDKM
VSKLEERIQNLEEGSCMDALVLPLHGSLPPEQQVRVFAPAPPNCRRFIVATNVAETSLTV
DGVVFVIDCGYVKQRQYNPSSGMYSLDVVQISRVQADQRAGRAGRTRPGKCYRLYPISIY
QKEFLEATIPEIQRSSLAGSVLYLKSLDLPDINILKFDFLDPPSRESLEDALRQLYLIDA
IDENGQITDVGRIMAELPLEPSLSRTLIEANELGCLSQALTVAAVLSAEITFRSTRSKDM
EGKRKRQELPDGSGWGDHIQLLQIFESWDRTGYDPRWCSDHELQVRGMKFSKDVRNQLSQ
IIQKIAKGSTDVQAKKERKSDPDYRKLRRALCVGYGNQLAERMLHHNGYHTVGYRAQLVQ
VHPFSVLEGDEYGKLPVYVVYHELINTTRPFMRNVSAVDQSWVKPILKKLERLDMNKLSG
GSSGSKDPEPLEDKQVSSPKKAMDVKQSDVDSKIQAARERYLARKGKK
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgccatcgccgccgccgccgccgcagccgtcgccgccggagctgccgatctcggagcac
gaggacgagatcatggctgcggtggaggcgaacccagtggtggtggtgatcggtgagacc
ggctcggggaagagcacccagctctcccagatactccaccgccgcggctacacccgccgt
ggtgccatagccgtcacccagccccgtcgcgtcgccgccgtctcggtttccaggagagta
gcacaggagctcagtgttccccttggtgatgaagttggttatgccatccgatttgaagat
agaacttcagagaaaacctgcataaagtacctgacagatggtgttcttctgcgcgaaagc
ctttcagaccctgagttgaagcagtattcagtaattattctggatgaagctcacgagcgc
agtttaaacactgatattcttctaggtttaatgaaacgattaattaaggatcgagcttca
gatttgaaagttctgatcacttctgctactcttgatggtttgaaagtgtcaaagttcttc
tctggatgtcctgtgttgaatatccctggaaccttattccctgtggagaagttttacagc
acagaacatccaacgaattatatagaatcttctctgagaaccgctatagatattcatgtt
aaggaatcccctggtgatgtcttaatattcatgacaggaaaggatgacattgataagatg
gtatcaaaattggaggaaagaattcaaaatctagaggaaggttcttgtatggatgctctt
gtccttccacttcacggttctttgccacctgaacaacaggtccgggtatttgctccagca
cctccaaattgtcgacgcttcattgttgcaacaaatgtagctgaaacatctcttactgtg
gatggtgttgtgtttgtgattgattgtggttatgtaaagcaacgccagtataacccatcg
tctggaatgtattcacttgacgtagttcagattagcagagtgcaggctgaccagcgagct
gggcgagctggaagaactcggcctgggaagtgctataggttatacccaatttccatttat
caaaaggagtttctcgaggctacaatcccagaaatccagcgttcttctcttgccggaagt
gttttgtatctaaaatcgttagatctacctgatatcaacatactgaagtttgatttcctt
gacccaccatctcgtgaatcattagaagatgctttgaggcaattatacctcatcgatgca
attgatgaaaatgggcaaataacagatgtaggacgaattatggcagagctccctcttgag
ccttctctttcaaggactttgattgaagcaaacgaattgggatgtctatctcaggcattg
actgttgctgcagttctgtcagctgaaatcacattccggtcaactagaagcaaagacatg
gagggaaagaggaaaaggcaagagcttcctgatggttctggttggggcgaccatatacag
ttgcttcagatatttgaaagttgggatcgaacaggctatgatccaagatggtgctcagat
catgagttgcaggtgagaggcatgaaattcagcaaagatgtgagaaaccaattaagtcag
attattcaaaaaattgcaaaaggttcaacagatgtgcaagcaaagaaagagcggaagagt
gaccctgattatagaaaattaaggagagctctatgtgttggatatggtaaccagctcgct
gagaggatgctgcatcacaatggttatcatacggttggatacagggcacaactagtgcag
gtgcatccattttccgtactggaaggtgatgaatacgggaaactgccggtatatgttgtc
taccatgagttaataaatactactcgtcctttcatgagaaatgttagtgccgtggatcag
tcttgggttaaacctatattgaagaagcttgaaagattggacatgaacaaattaagtggt
ggttccagcggatcgaaagatccagaacctctagaggataaacaagtaagctccccaaag
aaagcaatggatgttaaacaatctgacgtggacagtaaaatacaggcagctcgcgagcgc
tacctggctcgaaaaggcaagaaatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9267698
Entry
9267698           CDS       T01015                                 
Name
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9267698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:osa03041]
    9267698
Enzymes [BR:osa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9267698
Spliceosome [BR:osa03041]
 Complex C
  Other components
   Step II factors
    9267698
SSDB
Motif
Pfam: OB_NTP_bind HA2 Helicase_C DEAD S1 AAA_22 AAA_19 Flavi_DEAD AAA_30 AAA_16 PhoH Sigma54_activ_2 ABC_tran AAA_33 T2SSE TsaE
Other DBs
NCBI-GeneID: 9267698
NCBI-ProteinID: XP_015643744
UniProt: A0A0P0WW98 Q5Z9X4
LinkDB
Position
6:complement(13723695..13729987)
AA seq 1084 aa
MVAAKVSTPAGGAVRDGLRRLTQLSLVSKVCSELEAHLGVGDRVLAEFIVDLGRASPSVA
DFDAKLKAHGADLPDYLARTLHTVIHAIPTHADDAPAPAPQNPASRGTGARVCGKDKAEE
RVRDGDPGLYQVCRGKVTGLADAGCFVRLDDARGREGLVHVSEMPGRRIAVKRGQEVFVK
IVSVQGRNLGLSMRDVDQDTGKDLLPLQRARGEDDVPRPMANPWTDRAAATRRRTGVSGI
VIPEDNQTGTASSRRPIRRMSSPERWEMKQLIASGVLNAKDYPAFDDEDSEGMNYQEEGV
EEELEIELNEDEPAFLRGQGRSTIDVSPVRISTNPDGSLSRAAVLQSALIKEWRDIRNED
QRALVDSIPKDLNRPWEDPVPEVGGRYLAQELRGVGLSAESMPEWKKEAYGKTVTFGQTS
RLSILEQRQSLPIFRLKNELIEAVRDNQVLVVIGETGSGKTTQVTQYLAEAGYITRGKIA
CTQPRRVAAESVAKRVSEEFGCRLGEEVGYSIRFDDHTGPDTVIKYMTDGMLLREILLDT
DLSSYSVVMLDEAHERTIYTDILFALLKKLIRRRTDLKLIVTSATLDAEKFSGYFFDCNI
FTIPGRTYPVEILYSKQPESDYMHAALLTVSQIHLTEPEGDILLFLTGQEEIDHACQCLY
ERMKSLGRNVPELLIYAVYSAQPAEMQSKIFEPTPPGKRKVVVATNIAEASITIDGIYYV
IDPGFAKLNVYNPKQGLDSLIITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPP
TTTPEIQRINLGETVLNMKAMGINDLLSFDFMDPPAPQSLITAMEQLYNLGALDEEGLLT
RVGRRMAEFPQEPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREKQAQADRKRGN
FFQPEGDHLTLLTVYQAWKAKQFSGPWCYENFVQLTSLRRAQDVRKQLLEIMDKYKLNVV
SAGNDLTKVRKAITAGFFFHAARKDPQGGYRTIADHQQVYIHPASALFQQQPEWVIYHEV
VMTTKEYMREVTAIDPRWLVELAPRFYRSADPTKISKRKRQERIEPLYDRYNEPNSWRLS
KRRG
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggtggcggccaaggtgtcgacccctgccggcggcgcggtgcgcgacgggctccggcgg
ctcacgcagctctcgctcgtctccaaggtctgctcggagctggaggcgcacctcggcgtc
ggcgaccgcgtcctcgcggagttcatcgtcgacctgggccgcgcatccccttccgtcgca
gacttcgacgccaagctcaaggcccacggcgctgacctgccggactacctcgcgcgcacc
ctccacaccgtcatccacgccatccctacccacgccgacgacgcccccgcccccgccccc
caaaaccctgcctcccgtggcaccggtgcaagggtttgcgggaaggacaaggcggaggag
cgggtgagagatggggatccggggctgtaccaggtgtgccgcgggaaggtcaccggcctg
gcggacgccgggtgcttcgtccgcctcgacgacgcgcgcggccgcgaggggctcgtccat
gtctccgagatgcccggccgccgaatcgccgtgaagcgtgggcaggaggtgttcgtcaag
atcgtgtccgtgcaggggcgcaatctggggctgtcgatgcgggacgtcgaccaggacacg
gggaaggacctcctaccgttgcagcgtgctaggggggaggatgatgtgccgaggccgatg
gcgaatccgtggaccgatcgagccgccgccactaggagaaggacgggggtgtcaggaatt
gtgatccccgaggacaaccagactggcacggcatcgtcgcggcggccgattaggcggatg
agctcgccggagaggtgggaaatgaagcagctgattgcttcaggggttctgaatgcgaag
gattacccggcgttcgatgatgaggatagcgaggggatgaattaccaggaggaaggtgtg
gaggaggagcttgagattgagcttaatgaagatgagccagcattcttgcggggacagggt
cggtccacaattgatgtgtccccagtgaggatttccacgaaccctgatgggtcgctgagt
cgagcggcggttctgcagagtgcgcttatcaaggagtggcgtgatatcaggaacgaggat
caaagagcattggttgactccatcccaaaggatctgaatcggccatgggaggatcctgtg
cctgaggtcggtgggcggtatctcgcacaagagctacgcggtgttggattatctgctgaa
agcatgccagagtggaagaaagaggcttatgggaagactgtaacatttggtcagacttca
aggctttcaatcctggaacagaggcagagtcttccaatattcaggctgaagaatgagctt
atcgaagctgttcgtgacaatcaagttctggttgttattggtgagaccggttcagggaaa
acaacccaggttacacagtaccttgctgaggcaggctatattacgagggggaaaattgca
tgtactcagcctcgcagggtcgctgcagagtcagttgccaagcgagtatcggaagagttt
ggttgccgattgggagaggaagttggttactcaatacgttttgatgatcacactggacca
gatactgtcattaagtacatgacggatggcatgctccttcgtgaaattttgttggacact
gacctctctagttactccgtggtcatgcttgatgaggcacatgagaggactatatataca
gacattctctttgccttactcaagaagctaattaggcgtagaactgatctcaagttaata
gtcacttccgccactcttgatgcagagaagttctctggatatttcttcgattgtaatatt
tttacaattcccggaagaacatatcctgtggagatactctattcaaaacagccagagagt
gattacatgcatgctgcgctgctcacagtatcacagatccatctgactgaacctgaaggt
gatatcctcttgttcttaactggccaggaagagattgatcatgcctgtcagtgtctctat
gagaggatgaagtctctaggtaggaatgtaccagaattgctgatatatgcagtgtacagt
gctcagccagctgaaatgcagtcaaagatctttgaacctactcctcctgggaagaggaaa
gtggtcgtggccactaacatagcggaagcatctattacaatagatgggatatattatgta
attgacccaggatttgcaaaactcaatgtgtataacccaaaacaagggctggattcactg
atcatcacaccgatatctcaagcatcagctaaacagagggcagggcgtgctggacgtaca
ggcccaggaaagtgttatcgtctatacactgaaagtgcctatcgcaacgaaatgcccccc
acaactactccagaaattcagaggatcaacttgggggagacggtcctcaatatgaaggca
atgggaataaacgatctactgtcatttgacttcatggaccccccagctcctcaatcactc
ataactgcaatggaacaactgtacaaccttggtgccttagatgaggagggtctccttaca
agagtagggagaaggatggcggagtttccacaagaaccaccactttcaaagatgctcctt
gctagtgtggacctcggatgcagtgatgaaatactgaccatcattgcgatgattcaaact
gggaacatattctaccggccaagggaaaaacaagctcaagccgatcggaaaaggggcaac
tttttccaaccagaaggggatcacctcaccctgctcaccgtgtatcaggcgtggaaggca
aagcagttttcaggtccatggtgctatgagaattttgtccagctaacatccctgaggaga
gcacaggatgtcagaaaacagctccttgagattatggacaagtataagcttaacgttgtc
tctgcagggaatgatctcaccaaggtgaggaaagccatcactgctggcttcttcttccac
gctgccaggaaggatccccagggaggatacaggaccattgctgatcatcagcaggtgtat
atccaccctgccagcgctctcttccagcagcaaccagagtgggttatctatcatgaagtc
gtcatgaccacaaaagagtacatgagggaggtgacagccattgacccaagatggcttgtt
gaactggcaccgaggttctacagatctgcagacccaacgaagatcagtaagcggaagcgc
caagaaaggattgagcctctgtatgacagatacaacgagccaaactcatggcgcctcagc
aagcgccgagggtaa

DBGET integrated database retrieval system